ver.2
Home
|
Help
|
Advanced search
Previous release (v1)
2026-06-21 10:25:11, GGRNA.v2 : RefSeq release 233 (Jan, 2026)
LOCUS NM_001410421 2899 bp mRNA linear ROD 13-DEC-2025 DEFINITION Mus musculus claudin 2 (Cldn2), transcript variant 2, mRNA. ACCESSION NM_001410421 XM_006528490 VERSION NM_001410421.1 KEYWORDS RefSeq; RefSeq Select. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE 1 (bases 1 to 2899) AUTHORS Behm,C.V., Nyimanu,D., Galdino,O.A., Kanoo,S., Kim,Y.C., Lopez,N., Goodluck,H., Rowe,P.S., Evan,A.P., Sommer,A.J., Barr,M.N., Punshon,T., Vallon,V., Jackson,B.P., Williams,J.C. Jr. and Yu,A.S. TITLE Kidney-specific claudin-2 deficiency leads to medullary nephrocalcinosis in mice JOURNAL J Clin Invest 135 (23), e197807 (2025) PUBMED 41066193 REMARK Publication Status: Online-Only REFERENCE 2 (bases 1 to 2899) AUTHORS Oami,T., Abtahi,S., Shimazui,T., Chen,C.W., Sweat,Y.Y., Liang,Z., Burd,E.M., Farris,A.B., Roland,J.T., Tsukita,S., Ford,M.L., Turner,J.R. and Coopersmith,C.M. TITLE Claudin-2 upregulation enhances intestinal permeability, immune activation, dysbiosis, and mortality in sepsis JOURNAL Proc Natl Acad Sci U S A 121 (10), e2217877121 (2024) PUBMED 38412124 REMARK GeneRIF: Claudin-2 upregulation enhances intestinal permeability, immune activation, dysbiosis, and mortality in sepsis. REFERENCE 3 (bases 1 to 2899) AUTHORS Ahmad,R., Kumar,B., Thapa,I., Tamang,R.L., Yadav,S.K., Washington,M.K., Talmon,G.A., Yu,A.S., Bastola,D.K., Dhawan,P. and Singh,A.B. TITLE Claudin-2 protects against colitis-associated cancer by promoting colitis-associated mucosal healing JOURNAL J Clin Invest 133 (23), e170771 (2023) PUBMED 37815870 REMARK GeneRIF: Claudin-2 protects against colitis-associated cancer by promoting colitis-associated mucosal healing. Publication Status: Online-Only REFERENCE 4 (bases 1 to 2899) AUTHORS Ahmad,R., Kumar,B., Tamang,R.L., Talmon,G.A., Dhawan,P. and Singh,A.B. TITLE P62/SQSTM1 binds with claudin-2 to target for selective autophagy in stressed intestinal epithelium JOURNAL Commun Biol 6 (1), 740 (2023) PUBMED 37460613 REMARK GeneRIF: P62/SQSTM1 binds with claudin-2 to target for selective autophagy in stressed intestinal epithelium. Publication Status: Online-Only REFERENCE 5 (bases 1 to 2899) AUTHORS Beggs,M.R., Young,K., Plain,A., O'Neill,D.D., Raza,A., Flockerzi,V., Dimke,H. and Alexander,R.T. TITLE Maternal Epidermal Growth Factor Promotes Neonatal Claudin-2 Dependent Increases in Small Intestinal Calcium Permeability JOURNAL Function (Oxf) 4 (5), zqad033 (2023) PUBMED 37575484 REMARK Publication Status: Online-Only REFERENCE 6 (bases 1 to 2899) AUTHORS Kubota,K., Furuse,M., Sasaki,H., Sonoda,N., Fujita,K., Nagafuchi,A. and Tsukita,S. TITLE Ca(2+)-independent cell-adhesion activity of claudins, a family of integral membrane proteins localized at tight junctions JOURNAL Curr Biol 9 (18), 1035-1038 (1999) PUBMED 10508613 REFERENCE 7 (bases 1 to 2899) AUTHORS Morita,K., Furuse,M., Fujimoto,K. and Tsukita,S. TITLE Claudin multigene family encoding four-transmembrane domain protein components of tight junction strands JOURNAL Proc Natl Acad Sci U S A 96 (2), 511-516 (1999) PUBMED 9892664 REFERENCE 8 (bases 1 to 2899) AUTHORS Citi,S. and Cordenonsi,M. TITLE Tight junction proteins JOURNAL Biochim Biophys Acta 1448 (1), 1-11 (1998) PUBMED 9824655 REMARK Review article REFERENCE 9 (bases 1 to 2899) AUTHORS Furuse,M., Sasaki,H., Fujimoto,K. and Tsukita,S. TITLE A single gene product, claudin-1 or -2, reconstitutes tight junction strands and recruits occludin in fibroblasts JOURNAL J Cell Biol 143 (2), 391-401 (1998) PUBMED 9786950 REFERENCE 10 (bases 1 to 2899) AUTHORS Furuse,M., Fujita,K., Hiiragi,T., Fujimoto,K. and Tsukita,S. TITLE Claudin-1 and -2: novel integral membrane proteins localizing at tight junctions with no sequence similarity to occludin JOURNAL J Cell Biol 141 (7), 1539-1550 (1998) PUBMED 9647647 COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AL672243.12. On Aug 8, 2022 this sequence version replaced XM_006528490.4. Summary: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in maintaining cell polarity and signal transductions. The knockout mice lacking this gene display normal appearance, activity, growth and behavior, but are defective in the leaky and cation-selective paracellular permeability properties of renal proximal tubules. The proteins encoded by this gene and another family member Cldn12 are also critical for vitamin D-dependent Ca2+ absorption between enterocytes. [provided by RefSeq, Aug 2010]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: CK390708.1, CK031415.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMN00849381, SAMN00849385 [ECO:0000348] ##Evidence-Data-END## ##RefSeq-Attributes-START## RefSeq Select criteria :: based on conservation ##RefSeq-Attributes-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-38 AL672243.12 58614-58651 39-2899 AL672243.12 66153-69013 FEATURES Location/Qualifiers source 1..2899 /organism="Mus musculus" /mol_type="mRNA" /strain="C57BL/6" /db_xref="taxon:10090" /chromosome="X" /map="X 61.35 cM" gene 1..2899 /gene="Cldn2" /note="claudin 2" /db_xref="GeneID:12738" /db_xref="MGI:MGI:1276110" exon 1..38 /gene="Cldn2" /inference="alignment:Splign:2.1.0" exon 39..2899 /gene="Cldn2" /inference="alignment:Splign:2.1.0" misc_feature 137..139 /gene="Cldn2" /note="upstream in-frame stop codon" CDS 221..913 /gene="Cldn2" /codon_start=1 /product="claudin-2" /protein_id="NP_001397350.1" /db_xref="GeneID:12738" /db_xref="MGI:MGI:1276110" /translation="
MASLGVQLVGYILGLLGLLGTSIAMLLPNWRTSSYVGASIVTAVGFSKGLWMECATHSTGITQCDIYSTLLGLPADIQAAQAMMVTSSAMSSLACIISVVGMRCTVFCQDSRAKDRVAVVGGVFFILGGILGFIPVAWNLHGILRDFYSPLVPDSMKFEIGEALYLGIISALFSLVAGVILCFSCSPQGNRTNYYDGYQAQPLATRSSPRSAQQPKAKSEFNSYSLTGYV"
misc_feature 233..763
/gene="Cldn2"
/note="PMP-22/EMP/MP20/Claudin family; Region:
PMP22_Claudin; cl21598"
/db_xref="CDD:473919"
misc_feature 242..304
/gene="Cldn2"
/note="propagated from UniProtKB/Swiss-Prot (O88552.1);
transmembrane region"
misc_feature 413..415
/gene="Cldn2"
/note="Paracellular cation selectivity.
/evidence=ECO:0000269|PubMed:19114638; propagated from
UniProtKB/Swiss-Prot (O88552.1); other site"
misc_feature 464..526
/gene="Cldn2"
/note="propagated from UniProtKB/Swiss-Prot (O88552.1);
transmembrane region"
misc_feature 569..631
/gene="Cldn2"
/note="propagated from UniProtKB/Swiss-Prot (O88552.1);
transmembrane region"
misc_feature 707..769
/gene="Cldn2"
/note="propagated from UniProtKB/Swiss-Prot (O88552.1);
transmembrane region"
misc_feature 833..910
/gene="Cldn2"
/note="propagated from UniProtKB/Swiss-Prot (O88552.1);
Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
misc_feature 875..877
/gene="Cldn2"
/note="Phosphoserine.
/evidence=ECO:0007744|PubMed:21183079; propagated from
UniProtKB/Swiss-Prot (O88552.1); phosphorylation site"
misc_feature 887..889
/gene="Cldn2"
/note="Phosphoserine.
/evidence=ECO:0007744|PubMed:21183079; propagated from
UniProtKB/Swiss-Prot (O88552.1); phosphorylation site"
misc_feature 905..910
/gene="Cldn2"
/note="propagated from UniProtKB/Swiss-Prot (O88552.1);
Region: Interactions with TJP1, TJP2 and TJP3.
/evidence=ECO:0000250"
regulatory 2876..2881
/regulatory_class="polyA_signal_sequence"
/gene="Cldn2"
/note="hexamer: AATAAA"
polyA_site 2899
/gene="Cldn2"
/note="major polyA site"
ORIGIN
agagctcttcgaaaggacggctccgtgagtatctggtcgttttctagatgccttcttgagcctgcttgtggccacccacagatacttgtaaggaggaaagaagtcagcttgccagagacactgtgaaataagggattagaggctcggatccaagaagcaagagcagcagccaaacgacaagcaaacaggctccgaagatacttctactgagaggtctgccatggcctcccttggcgtccaactggtgggctacatcctaggccttttggggctgttaggcacatccattgccatgctgcttcccaactggcgaacgagttcctatgttggtgccagcattgtgacggcggttggcttttccaagggcctctggatggagtgtgcgacacacagcacaggcatcacccagtgcgatatctacagtacccttttaggacttcctgctgacatccaggctgcccaggccatgatggtgacgtccagtgcaatgtcctcgctggcttgtattatctctgtggtgggcatgagatgcaccgtgttctgccaggattctcgagctaaggacagagtggctgtagtgggtggagtctttttcatccttggtggcatcctgggctttatcccagttgcttggaatcttcatggcatccttcgggacttctactcgccgctggttcctgacagcatgaaatttgagattggagaggctctgtacttgggcatcatctcagccctgttttctttggtagccggagtcatcctttgcttttcctgctcgccccagggcaatcgtaccaactactatgatggctaccaggcccagcctcttgccactaggagctctccaagatctgctcaacagcccaaagccaagagtgagttcaactcatacagcctgactgggtatgtgtgaagaaccaggggccagagctgggggtagggtggggtagtggctgggactatatatataaaaaaaagcagtggacaatgcccccagggtcacaagcaaaggacattgccactgaatcatgtgtaaggtgctgctgagggtagaatgactttggccattggatggagtgaaggcagagatgagaagaggggtgtcagcatgtagatggcattgccaaggacgcttgccaagctagcttttctatttccctcacctgacctcactaaagtacctcctgtgctttgaatgctcaacccaaaagcccaaatcccatctctgccactttaggctatgcccagaggctctcttctgccctttggtttacttggagatctgtccccaaaccaatcatatcctgttgactaatcacctgtgatcaaaagaccctctccctctggctgaggttggctcttaactcaattactaagggacagagagaagaaagagtggtggcttctgtgaggacatttctagctcccttctcaaatctccagccaaagaaatggattagtcagtaatgggccctgaagcttctcttccagttttgctatgaatgcagtatgtccagactgcattgtgaatgaactgaaggaaagctatctcatggcatccagcagaatacagctgggtgcaggatgggaggcaacctgggatctaaagaaacaaaacaaacagcaaaacccgacagaatcccttctcaggccatctcctataattcccgtacatttgtgggtcagggatggaagcactgctaaggaaagcacaagaagccaagggaaagcacatggctgctgccctctgactccacagaggaattgcccagaagccaaggtgaacacggaccactgaaagctctgcctcccactggggtgtctgacccagcttcctgctaaaccacaagacttggagccctagacaagggtttccttaaggacaataaaccagtttttctagaactgccctttgacatgcgagttgcagaaggcttaaaaaaaatactaccctttagccctgaccgagaaagaataagggcttgggtatcaaagaaccggacagagatgtgtggtagctgttatgtgtgctcctactgtttcagagaggcagccctaccagatactttagacttgatggaagaccaacccatcagggtctatgtctcagcactacagagcctctgaaagaccacagcaccagagaggtcctttgtcacttttcacacttgagtcatcgcccatcagaagatactctcacaggtatgcaaagtctccagtgtggaacatctgtgaccaaggtgttgtgttcatgacctgagcaattggtgaacttctgcctgggattgtgcttgaggtgggagaacggagactggttccctgtccaacagttttatttccacggtcttaaaatgctccatttcttctgtggtagatgggggtcataaaccagagacatttccccaccaccaccagcttaatatcaccagcttcagaagatccccagcgcacctcatcaaaacttcagcaccggcaagagaggcccatatgtgaggtttcccttaacatgcctttcctatttccaccatattacttgtgttcaagctgatatgctgacctggaagccatttccttttaactaagtcatccccatgcttggagaacttgctcattgagccttctctgaccactccttcctgttctttcctttccctcctccaactcccaatatataaattgcctaatcctcatcattcataattttgattgatagtttatagttcttgtatgtgcatttgtgtgtgactctatccgtctgtctgtctgtgtgatctcaaaagttcactgtaagtacttggagggcaattgctatatcttagacctgtccatatgtatacccaagactgtaacagtgctgggcacacacaaggtgatcaataaacggatgttgattgagtaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]