GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-10-20 15:09:31, GGRNA.v2 : RefSeq release 232 (Sep, 2025)

LOCUS       NM_001410421            2899 bp    mRNA    linear   ROD 01-MAY-2025
DEFINITION  Mus musculus claudin 2 (Cldn2), transcript variant 2, mRNA.
ACCESSION   NM_001410421 XM_006528490
VERSION     NM_001410421.1
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Mus musculus (house mouse)
  ORGANISM  Mus musculus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Mus; Mus.
REFERENCE   1  (bases 1 to 2899)
  AUTHORS   Oami,T., Abtahi,S., Shimazui,T., Chen,C.W., Sweat,Y.Y., Liang,Z.,
            Burd,E.M., Farris,A.B., Roland,J.T., Tsukita,S., Ford,M.L.,
            Turner,J.R. and Coopersmith,C.M.
  TITLE     Claudin-2 upregulation enhances intestinal permeability, immune
            activation, dysbiosis, and mortality in sepsis
  JOURNAL   Proc Natl Acad Sci U S A 121 (10), e2217877121 (2024)
   PUBMED   38412124
  REMARK    GeneRIF: Claudin-2 upregulation enhances intestinal permeability,
            immune activation, dysbiosis, and mortality in sepsis.
REFERENCE   2  (bases 1 to 2899)
  AUTHORS   Ahmad,R., Kumar,B., Thapa,I., Tamang,R.L., Yadav,S.K.,
            Washington,M.K., Talmon,G.A., Yu,A.S., Bastola,D.K., Dhawan,P. and
            Singh,A.B.
  TITLE     Claudin-2 protects against colitis-associated cancer by promoting
            colitis-associated mucosal healing
  JOURNAL   J Clin Invest 133 (23), e170771 (2023)
   PUBMED   37815870
  REMARK    GeneRIF: Claudin-2 protects against colitis-associated cancer by
            promoting colitis-associated mucosal healing.
            Publication Status: Online-Only
REFERENCE   3  (bases 1 to 2899)
  AUTHORS   Ahmad,R., Kumar,B., Tamang,R.L., Talmon,G.A., Dhawan,P. and
            Singh,A.B.
  TITLE     P62/SQSTM1 binds with claudin-2 to target for selective autophagy
            in stressed intestinal epithelium
  JOURNAL   Commun Biol 6 (1), 740 (2023)
   PUBMED   37460613
  REMARK    GeneRIF: P62/SQSTM1 binds with claudin-2 to target for selective
            autophagy in stressed intestinal epithelium.
            Publication Status: Online-Only
REFERENCE   4  (bases 1 to 2899)
  AUTHORS   Beggs,M.R., Young,K., Plain,A., O'Neill,D.D., Raza,A.,
            Flockerzi,V., Dimke,H. and Alexander,R.T.
  TITLE     Maternal Epidermal Growth Factor Promotes Neonatal Claudin-2
            Dependent Increases in Small Intestinal Calcium Permeability
  JOURNAL   Function (Oxf) 4 (5), zqad033 (2023)
   PUBMED   37575484
  REMARK    Publication Status: Online-Only
REFERENCE   5  (bases 1 to 2899)
  AUTHORS   Cabuzu,D., Ramakrishnan,S.K., Moor,M.B., Harmacek,D., Auberson,M.,
            Durussel,F. and Bonny,O.
  TITLE     Loss of Ecrg4 improves calcium oxalate nephropathy
  JOURNAL   PLoS One 17 (10), e0275972 (2022)
   PUBMED   36227903
  REMARK    Publication Status: Online-Only
REFERENCE   6  (bases 1 to 2899)
  AUTHORS   Kubota,K., Furuse,M., Sasaki,H., Sonoda,N., Fujita,K., Nagafuchi,A.
            and Tsukita,S.
  TITLE     Ca(2+)-independent cell-adhesion activity of claudins, a family of
            integral membrane proteins localized at tight junctions
  JOURNAL   Curr Biol 9 (18), 1035-1038 (1999)
   PUBMED   10508613
REFERENCE   7  (bases 1 to 2899)
  AUTHORS   Morita,K., Furuse,M., Fujimoto,K. and Tsukita,S.
  TITLE     Claudin multigene family encoding four-transmembrane domain protein
            components of tight junction strands
  JOURNAL   Proc Natl Acad Sci U S A 96 (2), 511-516 (1999)
   PUBMED   9892664
REFERENCE   8  (bases 1 to 2899)
  AUTHORS   Citi,S. and Cordenonsi,M.
  TITLE     Tight junction proteins
  JOURNAL   Biochim Biophys Acta 1448 (1), 1-11 (1998)
   PUBMED   9824655
  REMARK    Review article
REFERENCE   9  (bases 1 to 2899)
  AUTHORS   Furuse,M., Sasaki,H., Fujimoto,K. and Tsukita,S.
  TITLE     A single gene product, claudin-1 or -2, reconstitutes tight
            junction strands and recruits occludin in fibroblasts
  JOURNAL   J Cell Biol 143 (2), 391-401 (1998)
   PUBMED   9786950
REFERENCE   10 (bases 1 to 2899)
  AUTHORS   Furuse,M., Fujita,K., Hiiragi,T., Fujimoto,K. and Tsukita,S.
  TITLE     Claudin-1 and -2: novel integral membrane proteins localizing at
            tight junctions with no sequence similarity to occludin
  JOURNAL   J Cell Biol 141 (7), 1539-1550 (1998)
   PUBMED   9647647
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from AL672243.12.
            
            On Aug 8, 2022 this sequence version replaced XM_006528490.4.
            
            Summary: This gene encodes a member of the claudin family. Claudins
            are integral membrane proteins and components of tight junction
            strands. Tight junction strands serve as a physical barrier to
            prevent solutes and water from passing freely through the
            paracellular space between epithelial or endothelial cell sheets,
            and also play critical roles in maintaining cell polarity and
            signal transductions. The knockout mice lacking this gene display
            normal appearance, activity, growth and behavior, but are defective
            in the leaky and cation-selective paracellular permeability
            properties of renal proximal tubules. The proteins encoded by this
            gene and another family member Cldn12 are also critical for vitamin
            D-dependent Ca2+ absorption between enterocytes. [provided by
            RefSeq, Aug 2010].
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: CK390708.1, CK031415.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMN00849381, SAMN00849385
                                           [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on conservation
            ##RefSeq-Attributes-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-38                AL672243.12        58614-58651
            39-2899             AL672243.12        66153-69013
FEATURES             Location/Qualifiers
     source          1..2899
                     /organism="Mus musculus"
                     /mol_type="mRNA"
                     /strain="C57BL/6"
                     /db_xref="taxon:10090"
                     /chromosome="X"
                     /map="X 61.35 cM"
     gene            1..2899
                     /gene="Cldn2"
                     /note="claudin 2"
                     /db_xref="GeneID:12738"
                     /db_xref="MGI:MGI:1276110"
     exon            1..38
                     /gene="Cldn2"
                     /inference="alignment:Splign:2.1.0"
     exon            39..2899
                     /gene="Cldn2"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    137..139
                     /gene="Cldn2"
                     /note="upstream in-frame stop codon"
     CDS             221..913
                     /gene="Cldn2"
                     /codon_start=1
                     /product="claudin-2"
                     /protein_id="NP_001397350.1"
                     /db_xref="GeneID:12738"
                     /db_xref="MGI:MGI:1276110"
                     /translation="
MASLGVQLVGYILGLLGLLGTSIAMLLPNWRTSSYVGASIVTAVGFSKGLWMECATHSTGITQCDIYSTLLGLPADIQAAQAMMVTSSAMSSLACIISVVGMRCTVFCQDSRAKDRVAVVGGVFFILGGILGFIPVAWNLHGILRDFYSPLVPDSMKFEIGEALYLGIISALFSLVAGVILCFSCSPQGNRTNYYDGYQAQPLATRSSPRSAQQPKAKSEFNSYSLTGYV"
     misc_feature    233..763
                     /gene="Cldn2"
                     /note="PMP-22/EMP/MP20/Claudin family; Region:
                     PMP22_Claudin; cl21598"
                     /db_xref="CDD:473919"
     misc_feature    242..304
                     /gene="Cldn2"
                     /note="propagated from UniProtKB/Swiss-Prot (O88552.1);
                     transmembrane region"
     misc_feature    413..415
                     /gene="Cldn2"
                     /note="Paracellular cation selectivity.
                     /evidence=ECO:0000269|PubMed:19114638; propagated from
                     UniProtKB/Swiss-Prot (O88552.1); other site"
     misc_feature    464..526
                     /gene="Cldn2"
                     /note="propagated from UniProtKB/Swiss-Prot (O88552.1);
                     transmembrane region"
     misc_feature    569..631
                     /gene="Cldn2"
                     /note="propagated from UniProtKB/Swiss-Prot (O88552.1);
                     transmembrane region"
     misc_feature    707..769
                     /gene="Cldn2"
                     /note="propagated from UniProtKB/Swiss-Prot (O88552.1);
                     transmembrane region"
     misc_feature    833..910
                     /gene="Cldn2"
                     /note="propagated from UniProtKB/Swiss-Prot (O88552.1);
                     Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
     misc_feature    875..877
                     /gene="Cldn2"
                     /note="Phosphoserine.
                     /evidence=ECO:0007744|PubMed:21183079; propagated from
                     UniProtKB/Swiss-Prot (O88552.1); phosphorylation site"
     misc_feature    887..889
                     /gene="Cldn2"
                     /note="Phosphoserine.
                     /evidence=ECO:0007744|PubMed:21183079; propagated from
                     UniProtKB/Swiss-Prot (O88552.1); phosphorylation site"
     misc_feature    905..910
                     /gene="Cldn2"
                     /note="propagated from UniProtKB/Swiss-Prot (O88552.1);
                     Region: Interactions with TJP1, TJP2 and TJP3.
                     /evidence=ECO:0000250"
     regulatory      2876..2881
                     /regulatory_class="polyA_signal_sequence"
                     /gene="Cldn2"
                     /note="hexamer: AATAAA"
     polyA_site      2899
                     /gene="Cldn2"
                     /note="major polyA site"
ORIGIN      
agagctcttcgaaaggacggctccgtgagtatctggtcgttttctagatgccttcttgagcctgcttgtggccacccacagatacttgtaaggaggaaagaagtcagcttgccagagacactgtgaaataagggattagaggctcggatccaagaagcaagagcagcagccaaacgacaagcaaacaggctccgaagatacttctactgagaggtctgccatggcctcccttggcgtccaactggtgggctacatcctaggccttttggggctgttaggcacatccattgccatgctgcttcccaactggcgaacgagttcctatgttggtgccagcattgtgacggcggttggcttttccaagggcctctggatggagtgtgcgacacacagcacaggcatcacccagtgcgatatctacagtacccttttaggacttcctgctgacatccaggctgcccaggccatgatggtgacgtccagtgcaatgtcctcgctggcttgtattatctctgtggtgggcatgagatgcaccgtgttctgccaggattctcgagctaaggacagagtggctgtagtgggtggagtctttttcatccttggtggcatcctgggctttatcccagttgcttggaatcttcatggcatccttcgggacttctactcgccgctggttcctgacagcatgaaatttgagattggagaggctctgtacttgggcatcatctcagccctgttttctttggtagccggagtcatcctttgcttttcctgctcgccccagggcaatcgtaccaactactatgatggctaccaggcccagcctcttgccactaggagctctccaagatctgctcaacagcccaaagccaagagtgagttcaactcatacagcctgactgggtatgtgtgaagaaccaggggccagagctgggggtagggtggggtagtggctgggactatatatataaaaaaaagcagtggacaatgcccccagggtcacaagcaaaggacattgccactgaatcatgtgtaaggtgctgctgagggtagaatgactttggccattggatggagtgaaggcagagatgagaagaggggtgtcagcatgtagatggcattgccaaggacgcttgccaagctagcttttctatttccctcacctgacctcactaaagtacctcctgtgctttgaatgctcaacccaaaagcccaaatcccatctctgccactttaggctatgcccagaggctctcttctgccctttggtttacttggagatctgtccccaaaccaatcatatcctgttgactaatcacctgtgatcaaaagaccctctccctctggctgaggttggctcttaactcaattactaagggacagagagaagaaagagtggtggcttctgtgaggacatttctagctcccttctcaaatctccagccaaagaaatggattagtcagtaatgggccctgaagcttctcttccagttttgctatgaatgcagtatgtccagactgcattgtgaatgaactgaaggaaagctatctcatggcatccagcagaatacagctgggtgcaggatgggaggcaacctgggatctaaagaaacaaaacaaacagcaaaacccgacagaatcccttctcaggccatctcctataattcccgtacatttgtgggtcagggatggaagcactgctaaggaaagcacaagaagccaagggaaagcacatggctgctgccctctgactccacagaggaattgcccagaagccaaggtgaacacggaccactgaaagctctgcctcccactggggtgtctgacccagcttcctgctaaaccacaagacttggagccctagacaagggtttccttaaggacaataaaccagtttttctagaactgccctttgacatgcgagttgcagaaggcttaaaaaaaatactaccctttagccctgaccgagaaagaataagggcttgggtatcaaagaaccggacagagatgtgtggtagctgttatgtgtgctcctactgtttcagagaggcagccctaccagatactttagacttgatggaagaccaacccatcagggtctatgtctcagcactacagagcctctgaaagaccacagcaccagagaggtcctttgtcacttttcacacttgagtcatcgcccatcagaagatactctcacaggtatgcaaagtctccagtgtggaacatctgtgaccaaggtgttgtgttcatgacctgagcaattggtgaacttctgcctgggattgtgcttgaggtgggagaacggagactggttccctgtccaacagttttatttccacggtcttaaaatgctccatttcttctgtggtagatgggggtcataaaccagagacatttccccaccaccaccagcttaatatcaccagcttcagaagatccccagcgcacctcatcaaaacttcagcaccggcaagagaggcccatatgtgaggtttcccttaacatgcctttcctatttccaccatattacttgtgttcaagctgatatgctgacctggaagccatttccttttaactaagtcatccccatgcttggagaacttgctcattgagccttctctgaccactccttcctgttctttcctttccctcctccaactcccaatatataaattgcctaatcctcatcattcataattttgattgatagtttatagttcttgtatgtgcatttgtgtgtgactctatccgtctgtctgtctgtgtgatctcaaaagttcactgtaagtacttggagggcaattgctatatcttagacctgtccatatgtatacccaagactgtaacagtgctgggcacacacaaggtgatcaataaacggatgttgattgagtaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]