GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-10-14 09:20:22, GGRNA.v2 : RefSeq release 232 (Sep, 2025)

LOCUS       NM_001360218            1010 bp    mRNA    linear   ROD 08-APR-2025
DEFINITION  Mus musculus NK2 homeobox 6 (Nkx2-6), transcript variant 2, mRNA.
ACCESSION   NM_001360218 XM_006518679
VERSION     NM_001360218.1
KEYWORDS    RefSeq.
SOURCE      Mus musculus (house mouse)
  ORGANISM  Mus musculus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Mus; Mus.
REFERENCE   1  (bases 1 to 1010)
  AUTHORS   Adams,D.J., Barlas,B., McIntyre,R.E., Salguero,I., van der
            Weyden,L., Barros,A., Vicente,J.R., Karimpour,N., Haider,A.,
            Ranzani,M., Turner,G., Thompson,N.A., Harle,V., Olvera-Leon,R.,
            Robles-Espinoza,C.D., Speak,A.O., Geisler,N., Weninger,W.J.,
            Geyer,S.H., Hewinson,J., Karp,N.A., Fu,B., Yang,F., Kozik,Z.,
            Choudhary,J., Yu,L., van Ruiten,M.S., Rowland,B.D., Lelliott,C.J.,
            Del Castillo Velasco-Herrera,M., Verstraten,R., Bruckner,L.,
            Henssen,A.G., Rooimans,M.A., de Lange,J., Mohun,T.J., Arends,M.J.,
            Kentistou,K.A., Coelho,P.A., Zhao,Y., Zecchini,H., Perry,J.R.B.,
            Jackson,S.P. and Balmus,G.
  CONSRTM   Sanger Mouse Genetics Project
  TITLE     Genetic determinants of micronucleus formation in vivo
  JOURNAL   Nature 627 (8002), 130-136 (2024)
   PUBMED   38355793
REFERENCE   2  (bases 1 to 1010)
  AUTHORS   Zhang,Q., Carlin,D., Zhu,F., Cattaneo,P., Ideker,T., Evans,S.M.,
            Bloomekatz,J. and Chi,N.C.
  TITLE     Unveiling Complexity and Multipotentiality of Early Heart Fields
  JOURNAL   Circ Res 129 (4), 474-487 (2021)
   PUBMED   34162224
  REMARK    Erratum:[Circ Res. 2021 Sep 3;129(6):e119. doi:
            10.1161/RES.0000000000000505. PMID: 34473533]
REFERENCE   3  (bases 1 to 1010)
  AUTHORS   Gao,R., Liang,X., Cheedipudi,S., Cordero,J., Jiang,X., Zhang,Q.,
            Caputo,L., Gunther,S., Kuenne,C., Ren,Y., Bhattacharya,S., Yuan,X.,
            Barreto,G., Chen,Y., Braun,T., Evans,S.M., Sun,Y. and Dobreva,G.
  TITLE     Pioneering function of Isl1 in the epigenetic control of
            cardiomyocyte cell fate
  JOURNAL   Cell Res 29 (6), 486-501 (2019)
   PUBMED   31024170
REFERENCE   4  (bases 1 to 1010)
  AUTHORS   Thompson,C.L., Ng,L., Menon,V., Martinez,S., Lee,C.K.,
            Glattfelder,K., Sunkin,S.M., Henry,A., Lau,C., Dang,C.,
            Garcia-Lopez,R., Martinez-Ferre,A., Pombero,A., Rubenstein,J.L.R.,
            Wakeman,W.B., Hohmann,J., Dee,N., Sodt,A.J., Young,R., Smith,K.,
            Nguyen,T.N., Kidney,J., Kuan,L., Jeromin,A., Kaykas,A., Miller,J.,
            Page,D., Orta,G., Bernard,A., Riley,Z., Smith,S., Wohnoutka,P.,
            Hawrylycz,M.J., Puelles,L. and Jones,A.R.
  TITLE     A high-resolution spatiotemporal atlas of gene expression of the
            developing mouse brain
  JOURNAL   Neuron 83 (2), 309-323 (2014)
   PUBMED   24952961
REFERENCE   5  (bases 1 to 1010)
  AUTHORS   Wei,Q. and Condie,B.G.
  TITLE     A focused in situ hybridization screen identifies candidate
            transcriptional regulators of thymic epithelial cell development
            and function
  JOURNAL   PLoS One 6 (11), e26795 (2011)
   PUBMED   22087235
REFERENCE   6  (bases 1 to 1010)
  AUTHORS   Nikolova,M., Chen,X. and Lufkin,T.
  TITLE     Nkx2.6 expression is transiently and specifically restricted to the
            branchial region of pharyngeal-stage mouse embryos
  JOURNAL   Mech Dev 69 (1-2), 215-218 (1997)
   PUBMED   9486544
REFERENCE   7  (bases 1 to 1010)
  AUTHORS   Yoshiura,K.I. and Murray,J.C.
  TITLE     Sequence and chromosomal assignment of human BAPX1, a
            bagpipe-related gene, to 4p16.1: a candidate gene for skeletal
            dysplasia
  JOURNAL   Genomics 45 (2), 425-428 (1997)
   PUBMED   9344671
REFERENCE   8  (bases 1 to 1010)
  AUTHORS   O'Brien,E.P., Zhen,L., Jiang,S.Y., Novak,E.K. and Swank,R.T.
  TITLE     High-resolution genetic mapping of the gunmetal gene which
            regulates platelet production
  JOURNAL   Mamm Genome 7 (3), 206-208 (1996)
   PUBMED   8833241
REFERENCE   9  (bases 1 to 1010)
  AUTHORS   Copeland,N.G., Jenkins,N.A. and Harvey,R.P.
  TITLE     The murine homeobox genes Nkx2.3 and Nkx2.6 are located on
            chromosomes 19 and 14, respectively
  JOURNAL   Genomics 22 (3), 655-656 (1994)
   PUBMED   8001981
REFERENCE   10 (bases 1 to 1010)
  AUTHORS   Lints,T.J., Parsons,L.M., Hartley,L., Lyons,I. and Harvey,R.P.
  TITLE     Nkx-2.5: a novel murine homeobox gene expressed in early heart
            progenitor cells and their myogenic descendants
  JOURNAL   Development 119 (2), 419-431 (1993)
   PUBMED   7904557
  REMARK    Erratum:[Development. 1993 Nov;119(3):969. doi:
            10.1242/dev.119.3.969. PMID: 7910553]
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            CT025562.10, AK006401.1 and AK007304.1.
            
            On Jan 30, 2018 this sequence version replaced XM_006518679.1.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BC145516.1, AK006401.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMN00849383, SAMN00849384
                                           [ECO:0000348]
            ##Evidence-Data-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-1                 CT025562.10        94024-94024
            2-980               AK006401.1         4-982
            981-1010            AK007304.1         910-939
FEATURES             Location/Qualifiers
     source          1..1010
                     /organism="Mus musculus"
                     /mol_type="mRNA"
                     /strain="C57BL/6"
                     /db_xref="taxon:10090"
                     /chromosome="14"
                     /map="14 36.01 cM"
     gene            1..1010
                     /gene="Nkx2-6"
                     /gene_synonym="Nkx-2.6; Nkx2.6; tinman; Tix"
                     /note="NK2 homeobox 6"
                     /db_xref="GeneID:18092"
                     /db_xref="MGI:MGI:97351"
     exon            1..101
                     /gene="Nkx2-6"
                     /gene_synonym="Nkx-2.6; Nkx2.6; tinman; Tix"
                     /inference="alignment:Splign:2.1.0"
     exon            102..1010
                     /gene="Nkx2-6"
                     /gene_synonym="Nkx-2.6; Nkx2.6; tinman; Tix"
                     /inference="alignment:Splign:2.1.0"
     CDS             146..724
                     /gene="Nkx2-6"
                     /gene_synonym="Nkx-2.6; Nkx2.6; tinman; Tix"
                     /note="isoform 2 is encoded by transcript variant 2;
                     homeobox protein Nkx-2.6; homeobox protein NK-2 homolog F;
                     Drosophila NK2 transcription factor related, locus 6"
                     /codon_start=1
                     /product="homeobox protein Nkx-2.6 isoform 2"
                     /protein_id="NP_001347147.1"
                     /db_xref="GeneID:18092"
                     /db_xref="MGI:MGI:97351"
                     /translation="
MTDRGVGNLSGDMRRGGPVSTRTRPQRKSRVLFSQAQVLALERRFKQQRYLTAPEREHLASALQLTSTQVKIWFQNRRYKSKSQRQDQTLELAGHPLAPRRVAVPVLVLDGKPCLDPDVAAFLGPYKATSPYSCFGGYAGTPYDASYASRCTSASAGPGPLTPLASSGFSPGGQSAAPQGHLPATPQGVTAW"
     misc_feature    224..391
                     /gene="Nkx2-6"
                     /gene_synonym="Nkx-2.6; Nkx2.6; tinman; Tix"
                     /note="Region: Homeodomain; pfam00046"
                     /db_xref="CDD:459649"
     regulatory      943..948
                     /regulatory_class="polyA_signal_sequence"
                     /gene="Nkx2-6"
                     /gene_synonym="Nkx-2.6; Nkx2.6; tinman; Tix"
                     /note="hexamer: AATAAA"
     polyA_site      983
                     /gene="Nkx2-6"
                     /gene_synonym="Nkx-2.6; Nkx2.6; tinman; Tix"
                     /note="major polyA site"
ORIGIN      
ggatggtttgagagcagcgacagggcacaagcagtcccttttcggtgcacctgggagacagtcctggagatgggctcgaatcctgtgggggagccacgtaaaaactcctccgggcacgatctcccgacttggagccaggaacccaatgaccgatcgcggcgtgggcaacctgagtggcgacatgcgccgaggcggtccggtttcaaccagaacgcggccacagcggaagtcccgcgtgctattctcccaggcccaagtgctggccctggagcggcgcttcaagcagcagcgatacctgactgcgcccgagcgtgagcacttggccagcgcgctgcagctcacgtccacgcaggtcaagatctggttccaaaaccggcgctacaagtccaagagtcagcgccaggaccagactctggaactggccggccacccgttagcaccgcgccgggtagcagtgccagtactggtactggacggcaagccctgcctggatcccgacgtagccgcattcctgggtccctacaaagccacctcgccctattcctgcttcggtggctacgcgggcactccctacgacgctagctatgcgagccgctgcaccagcgccagcgccggccccgggccgctcacaccactggccagctctggcttcagcccaggtggccaaagtgcggctccgcagggccatctgcccgctacgcctcagggagtcacggcctggtgaaaagcctgagctcacctactgccattcggtgcctgatgcctggtcccctccccttcctgctggtgggcgcggggctggaaagcactgcccaccttactgatctcggaactgaactgcttggaggagcggcccctgaagaccttgagaacattctttccctcggaagtgtaaccacgtagccacgtagatgctgtgcagaaagactagcacaagaaattaataaatcttattcccttgcccttctggcctagaaaagtaatagaagcagccgtgtactgcattatgg
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]