2025-10-14 09:20:22, GGRNA.v2 : RefSeq release 232 (Sep, 2025)
LOCUS NM_001360218 1010 bp mRNA linear ROD 08-APR-2025 DEFINITION Mus musculus NK2 homeobox 6 (Nkx2-6), transcript variant 2, mRNA. ACCESSION NM_001360218 XM_006518679 VERSION NM_001360218.1 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE 1 (bases 1 to 1010) AUTHORS Adams,D.J., Barlas,B., McIntyre,R.E., Salguero,I., van der Weyden,L., Barros,A., Vicente,J.R., Karimpour,N., Haider,A., Ranzani,M., Turner,G., Thompson,N.A., Harle,V., Olvera-Leon,R., Robles-Espinoza,C.D., Speak,A.O., Geisler,N., Weninger,W.J., Geyer,S.H., Hewinson,J., Karp,N.A., Fu,B., Yang,F., Kozik,Z., Choudhary,J., Yu,L., van Ruiten,M.S., Rowland,B.D., Lelliott,C.J., Del Castillo Velasco-Herrera,M., Verstraten,R., Bruckner,L., Henssen,A.G., Rooimans,M.A., de Lange,J., Mohun,T.J., Arends,M.J., Kentistou,K.A., Coelho,P.A., Zhao,Y., Zecchini,H., Perry,J.R.B., Jackson,S.P. and Balmus,G. CONSRTM Sanger Mouse Genetics Project TITLE Genetic determinants of micronucleus formation in vivo JOURNAL Nature 627 (8002), 130-136 (2024) PUBMED 38355793 REFERENCE 2 (bases 1 to 1010) AUTHORS Zhang,Q., Carlin,D., Zhu,F., Cattaneo,P., Ideker,T., Evans,S.M., Bloomekatz,J. and Chi,N.C. TITLE Unveiling Complexity and Multipotentiality of Early Heart Fields JOURNAL Circ Res 129 (4), 474-487 (2021) PUBMED 34162224 REMARK Erratum:[Circ Res. 2021 Sep 3;129(6):e119. doi: 10.1161/RES.0000000000000505. PMID: 34473533] REFERENCE 3 (bases 1 to 1010) AUTHORS Gao,R., Liang,X., Cheedipudi,S., Cordero,J., Jiang,X., Zhang,Q., Caputo,L., Gunther,S., Kuenne,C., Ren,Y., Bhattacharya,S., Yuan,X., Barreto,G., Chen,Y., Braun,T., Evans,S.M., Sun,Y. and Dobreva,G. TITLE Pioneering function of Isl1 in the epigenetic control of cardiomyocyte cell fate JOURNAL Cell Res 29 (6), 486-501 (2019) PUBMED 31024170 REFERENCE 4 (bases 1 to 1010) AUTHORS Thompson,C.L., Ng,L., Menon,V., Martinez,S., Lee,C.K., Glattfelder,K., Sunkin,S.M., Henry,A., Lau,C., Dang,C., Garcia-Lopez,R., Martinez-Ferre,A., Pombero,A., Rubenstein,J.L.R., Wakeman,W.B., Hohmann,J., Dee,N., Sodt,A.J., Young,R., Smith,K., Nguyen,T.N., Kidney,J., Kuan,L., Jeromin,A., Kaykas,A., Miller,J., Page,D., Orta,G., Bernard,A., Riley,Z., Smith,S., Wohnoutka,P., Hawrylycz,M.J., Puelles,L. and Jones,A.R. TITLE A high-resolution spatiotemporal atlas of gene expression of the developing mouse brain JOURNAL Neuron 83 (2), 309-323 (2014) PUBMED 24952961 REFERENCE 5 (bases 1 to 1010) AUTHORS Wei,Q. and Condie,B.G. TITLE A focused in situ hybridization screen identifies candidate transcriptional regulators of thymic epithelial cell development and function JOURNAL PLoS One 6 (11), e26795 (2011) PUBMED 22087235 REFERENCE 6 (bases 1 to 1010) AUTHORS Nikolova,M., Chen,X. and Lufkin,T. TITLE Nkx2.6 expression is transiently and specifically restricted to the branchial region of pharyngeal-stage mouse embryos JOURNAL Mech Dev 69 (1-2), 215-218 (1997) PUBMED 9486544 REFERENCE 7 (bases 1 to 1010) AUTHORS Yoshiura,K.I. and Murray,J.C. TITLE Sequence and chromosomal assignment of human BAPX1, a bagpipe-related gene, to 4p16.1: a candidate gene for skeletal dysplasia JOURNAL Genomics 45 (2), 425-428 (1997) PUBMED 9344671 REFERENCE 8 (bases 1 to 1010) AUTHORS O'Brien,E.P., Zhen,L., Jiang,S.Y., Novak,E.K. and Swank,R.T. TITLE High-resolution genetic mapping of the gunmetal gene which regulates platelet production JOURNAL Mamm Genome 7 (3), 206-208 (1996) PUBMED 8833241 REFERENCE 9 (bases 1 to 1010) AUTHORS Copeland,N.G., Jenkins,N.A. and Harvey,R.P. TITLE The murine homeobox genes Nkx2.3 and Nkx2.6 are located on chromosomes 19 and 14, respectively JOURNAL Genomics 22 (3), 655-656 (1994) PUBMED 8001981 REFERENCE 10 (bases 1 to 1010) AUTHORS Lints,T.J., Parsons,L.M., Hartley,L., Lyons,I. and Harvey,R.P. TITLE Nkx-2.5: a novel murine homeobox gene expressed in early heart progenitor cells and their myogenic descendants JOURNAL Development 119 (2), 419-431 (1993) PUBMED 7904557 REMARK Erratum:[Development. 1993 Nov;119(3):969. doi: 10.1242/dev.119.3.969. PMID: 7910553] COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from CT025562.10, AK006401.1 and AK007304.1. On Jan 30, 2018 this sequence version replaced XM_006518679.1. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: BC145516.1, AK006401.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMN00849383, SAMN00849384 [ECO:0000348] ##Evidence-Data-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-1 CT025562.10 94024-94024 2-980 AK006401.1 4-982 981-1010 AK007304.1 910-939 FEATURES Location/Qualifiers source 1..1010 /organism="Mus musculus" /mol_type="mRNA" /strain="C57BL/6" /db_xref="taxon:10090" /chromosome="14" /map="14 36.01 cM" gene 1..1010 /gene="Nkx2-6" /gene_synonym="Nkx-2.6; Nkx2.6; tinman; Tix" /note="NK2 homeobox 6" /db_xref="GeneID:18092" /db_xref="MGI:MGI:97351" exon 1..101 /gene="Nkx2-6" /gene_synonym="Nkx-2.6; Nkx2.6; tinman; Tix" /inference="alignment:Splign:2.1.0" exon 102..1010 /gene="Nkx2-6" /gene_synonym="Nkx-2.6; Nkx2.6; tinman; Tix" /inference="alignment:Splign:2.1.0" CDS 146..724 /gene="Nkx2-6" /gene_synonym="Nkx-2.6; Nkx2.6; tinman; Tix" /note="isoform 2 is encoded by transcript variant 2; homeobox protein Nkx-2.6; homeobox protein NK-2 homolog F; Drosophila NK2 transcription factor related, locus 6" /codon_start=1 /product="homeobox protein Nkx-2.6 isoform 2" /protein_id="NP_001347147.1" /db_xref="GeneID:18092" /db_xref="MGI:MGI:97351" /translation="
MTDRGVGNLSGDMRRGGPVSTRTRPQRKSRVLFSQAQVLALERRFKQQRYLTAPEREHLASALQLTSTQVKIWFQNRRYKSKSQRQDQTLELAGHPLAPRRVAVPVLVLDGKPCLDPDVAAFLGPYKATSPYSCFGGYAGTPYDASYASRCTSASAGPGPLTPLASSGFSPGGQSAAPQGHLPATPQGVTAW"
misc_feature 224..391 /gene="Nkx2-6" /gene_synonym="Nkx-2.6; Nkx2.6; tinman; Tix" /note="Region: Homeodomain; pfam00046" /db_xref="CDD:459649" regulatory 943..948 /regulatory_class="polyA_signal_sequence" /gene="Nkx2-6" /gene_synonym="Nkx-2.6; Nkx2.6; tinman; Tix" /note="hexamer: AATAAA" polyA_site 983 /gene="Nkx2-6" /gene_synonym="Nkx-2.6; Nkx2.6; tinman; Tix" /note="major polyA site" ORIGIN
ggatggtttgagagcagcgacagggcacaagcagtcccttttcggtgcacctgggagacagtcctggagatgggctcgaatcctgtgggggagccacgtaaaaactcctccgggcacgatctcccgacttggagccaggaacccaatgaccgatcgcggcgtgggcaacctgagtggcgacatgcgccgaggcggtccggtttcaaccagaacgcggccacagcggaagtcccgcgtgctattctcccaggcccaagtgctggccctggagcggcgcttcaagcagcagcgatacctgactgcgcccgagcgtgagcacttggccagcgcgctgcagctcacgtccacgcaggtcaagatctggttccaaaaccggcgctacaagtccaagagtcagcgccaggaccagactctggaactggccggccacccgttagcaccgcgccgggtagcagtgccagtactggtactggacggcaagccctgcctggatcccgacgtagccgcattcctgggtccctacaaagccacctcgccctattcctgcttcggtggctacgcgggcactccctacgacgctagctatgcgagccgctgcaccagcgccagcgccggccccgggccgctcacaccactggccagctctggcttcagcccaggtggccaaagtgcggctccgcagggccatctgcccgctacgcctcagggagtcacggcctggtgaaaagcctgagctcacctactgccattcggtgcctgatgcctggtcccctccccttcctgctggtgggcgcggggctggaaagcactgcccaccttactgatctcggaactgaactgcttggaggagcggcccctgaagaccttgagaacattctttccctcggaagtgtaaccacgtagccacgtagatgctgtgcagaaagactagcacaagaaattaataaatcttattcccttgcccttctggcctagaaaagtaatagaagcagccgtgtactgcattatgg
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]