2025-10-17 03:28:43, GGRNA.v2 : RefSeq release 232 (Sep, 2025)
LOCUS NM_001347434 1469 bp mRNA linear ROD 28-APR-2025 DEFINITION Mus musculus microfibrillar associated protein 5 (Mfap5), transcript variant 2, mRNA. ACCESSION NM_001347434 XM_006506364 VERSION NM_001347434.1 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE 1 (bases 1 to 1469) AUTHORS Chen,Z., Zhao,Q., Chen,L., Gao,S., Meng,L., Liu,Y., Wang,Y., Li,T. and Xue,J. TITLE MAGP2 promotes osteogenic differentiation during fracture healing through its crosstalk with the beta-catenin pathway JOURNAL J Cell Physiol 239 (4), e31183 (2024) PUBMED 38348695 REMARK GeneRIF: MAGP2 promotes osteogenic differentiation during fracture healing through its crosstalk with the beta-catenin pathway. REFERENCE 2 (bases 1 to 1469) AUTHORS Jacob,T., Annusver,K., Czarnewski,P., Dalessandri,T., Kalk,C., Levra Levron,C., Campama Sanz,N., Kastriti,M.E., Mikkola,M.L., Rendl,M., Lichtenberger,B.M., Donati,G., Bjorklund,A.K. and Kasper,M. TITLE Molecular and spatial landmarks of early mouse skin development JOURNAL Dev Cell 58 (20), 2140-2162 (2023) PUBMED 37591247 REFERENCE 3 (bases 1 to 1469) AUTHORS Hofling,C., Rossner,S., Flachmeyer,B., Krueger,M., Hartig,W. and Michalski,D. TITLE Tricellulin, alpha-Catenin and Microfibrillar-Associated Protein 5 Exhibit Concomitantly Altered Immunosignals along with Vascular, Extracellular and Cytoskeletal Elements after Experimental Focal Cerebral Ischemia JOURNAL Int J Mol Sci 24 (15), 11893 (2023) PUBMED 37569268 REMARK GeneRIF: Tricellulin, alpha-Catenin and Microfibrillar-Associated Protein 5 Exhibit Concomitantly Altered Immunosignals along with Vascular, Extracellular and Cytoskeletal Elements after Experimental Focal Cerebral Ischemia. Publication Status: Online-Only REFERENCE 4 (bases 1 to 1469) AUTHORS Chen,Z., Zhao,H., Meng,L., Yu,S., Liu,Z. and Xue,J. TITLE Microfibril-Associated Glycoprotein-2 Promoted Fracture Healing via Integrin alphavbeta3/PTK2/AKT Signaling JOURNAL Lab Invest 103 (7), 100121 (2023) PUBMED 36934797 REMARK GeneRIF: Microfibril-Associated Glycoprotein-2 Promoted Fracture Healing via Integrin alphavbeta3/PTK2/AKT Signaling. REFERENCE 5 (bases 1 to 1469) AUTHORS Han,C., Leonardo,T.R., Romana-Souza,B., Shi,J., Keiser,S., Yuan,H., Altakriti,M., Ranzer,M.J., Ferri-Borgogno,S., Mok,S.C., Koh,T.J., Hong,S.J., Chen,L. and DiPietro,L.A. TITLE Microfibril-associated protein 5 and the regulation of skin scar formation JOURNAL Sci Rep 13 (1), 8728 (2023) PUBMED 37253753 REMARK GeneRIF: Microfibril-associated protein 5 and the regulation of skin scar formation. Publication Status: Online-Only REFERENCE 6 (bases 1 to 1469) AUTHORS Nehring,L.C., Miyamoto,A., Hein,P.W., Weinmaster,G. and Shipley,J.M. TITLE The extracellular matrix protein MAGP-2 interacts with Jagged1 and induces its shedding from the cell surface JOURNAL J Biol Chem 280 (21), 20349-20355 (2005) PUBMED 15788413 REFERENCE 7 (bases 1 to 1469) AUTHORS Lemaire,R., Farina,G., Kissin,E., Shipley,J.M., Bona,C., Korn,J.H. and Lafyatis,R. TITLE Mutant fibrillin 1 from tight skin mice increases extracellular matrix incorporation of microfibril-associated glycoprotein 2 and type I collagen JOURNAL Arthritis Rheum 50 (3), 915-926 (2004) PUBMED 15022335 REMARK GeneRIF: Tight skin fibrillin 1 altered extracellular matrix organization and caused fibrosis by affecting deposition of MAGP-2 or other fibrillin-1-associated proteins. REFERENCE 8 (bases 1 to 1469) AUTHORS Penner,A.S., Rock,M.J., Kielty,C.M. and Shipley,J.M. TITLE Microfibril-associated glycoprotein-2 interacts with fibrillin-1 and fibrillin-2 suggesting a role for MAGP-2 in elastic fiber assembly JOURNAL J Biol Chem 277 (38), 35044-35049 (2002) PUBMED 12122015 REMARK GeneRIF: interaction with fibrillin-1 and fibrillin-2 suggesting role in elastic fiber assembly REFERENCE 9 (bases 1 to 1469) AUTHORS Shipley,J.M., Mecham,R.P., Maus,E., Bonadio,J., Rosenbloom,J., McCarthy,R.T., Baumann,M.L., Frankfater,C., Segade,F. and Shapiro,S.D. TITLE Developmental expression of latent transforming growth factor beta binding protein 2 and its requirement early in mouse development JOURNAL Mol Cell Biol 20 (13), 4879-4887 (2000) PUBMED 10848613 REFERENCE 10 (bases 1 to 1469) AUTHORS Frankfater,C., Maus,E., Gaal,K., Segade,F., Copeland,N.G., Gilbert,D.J., Jenkins,N.A. and Shipley,J.M. TITLE Organization of the mouse microfibril-associated glycoprotein-2 (MAGP-2) gene JOURNAL Mamm Genome 11 (3), 191-195 (2000) PUBMED 10723723 COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from AC155946.7. On Nov 26, 2016 this sequence version replaced XM_006506364.3. Transcript Variant: This variant (2) lacks an alternate in-frame exon in the 5' coding region compared to variant 1. It encodes isoform 2 which is shorter compared to isoform 1. Sequence Note: The RefSeq transcript and protein were derived from genomic sequence to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on alignments. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: DV061445.1, ERR3835353.125048.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMN00849374, SAMN00849375 [ECO:0000348] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end. PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-149 AC155946.7 121370-121518 150-209 AC155946.7 122127-122186 210-245 AC155946.7 123134-123169 246-278 AC155946.7 128365-128397 279-311 AC155946.7 128682-128714 312-335 AC155946.7 132273-132296 336-423 AC155946.7 133737-133824 424-497 AC155946.7 134573-134646 498-1469 AC155946.7 136105-137076 FEATURES Location/Qualifiers source 1..1469 /organism="Mus musculus" /mol_type="mRNA" /strain="C57BL/6" /db_xref="taxon:10090" /chromosome="6" /map="6 57.61 cM" gene 1..1469 /gene="Mfap5" /gene_synonym="MAGP-2; MFAP-5" /note="microfibrillar associated protein 5" /db_xref="GeneID:50530" /db_xref="MGI:MGI:1354387" exon 1..149 /gene="Mfap5" /gene_synonym="MAGP-2; MFAP-5" /inference="alignment:Splign:2.1.0" misc_feature 86..88 /gene="Mfap5" /gene_synonym="MAGP-2; MFAP-5" /note="upstream in-frame stop codon" exon 150..209 /gene="Mfap5" /gene_synonym="MAGP-2; MFAP-5" /inference="alignment:Splign:2.1.0" CDS 152..610 /gene="Mfap5" /gene_synonym="MAGP-2; MFAP-5" /note="isoform 2 precursor is encoded by transcript variant 2; microfibril-associated glycoprotein 2" /codon_start=1 /product="microfibrillar-associated protein 5 isoform 2 precursor" /protein_id="NP_001334363.1" /db_xref="CCDS:CCDS85155.1" /db_xref="GeneID:50530" /db_xref="MGI:MGI:1354387" /translation="
MLFLGQKALLLVLAISIPSDWLPLGVSGQRGDDVPETFTDDPNLVNDPSTDDTAGDKNATAECRDEKFACTRLYSVHRPVRQCVHQSCFTSLRRMYIINNEICSRLVCKEHEAMKDELCRQMAGLPPRRLRRSNYFRLPPCENMNLQRPDGL"
sig_peptide 152..235 /gene="Mfap5" /gene_synonym="MAGP-2; MFAP-5" /inference="COORDINATES: ab initio prediction:SignalP:6.0" misc_feature 155..517 /gene="Mfap5" /gene_synonym="MAGP-2; MFAP-5" /note="Microfibril-associated glycoprotein (MAGP); Region: MAGP; pfam05507" /db_xref="CDD:461667" exon 210..245 /gene="Mfap5" /gene_synonym="MAGP-2; MFAP-5" /inference="alignment:Splign:2.1.0" exon 246..278 /gene="Mfap5" /gene_synonym="MAGP-2; MFAP-5" /inference="alignment:Splign:2.1.0" exon 279..311 /gene="Mfap5" /gene_synonym="MAGP-2; MFAP-5" /inference="alignment:Splign:2.1.0" exon 312..335 /gene="Mfap5" /gene_synonym="MAGP-2; MFAP-5" /inference="alignment:Splign:2.1.0" exon 336..423 /gene="Mfap5" /gene_synonym="MAGP-2; MFAP-5" /inference="alignment:Splign:2.1.0" exon 424..497 /gene="Mfap5" /gene_synonym="MAGP-2; MFAP-5" /inference="alignment:Splign:2.1.0" exon 498..1469 /gene="Mfap5" /gene_synonym="MAGP-2; MFAP-5" /inference="alignment:Splign:2.1.0" regulatory 792..797 /regulatory_class="polyA_signal_sequence" /gene="Mfap5" /gene_synonym="MAGP-2; MFAP-5" /note="hexamer: AATACA" polyA_site 814 /gene="Mfap5" /gene_synonym="MAGP-2; MFAP-5" /note="major polyA site" regulatory 1443..1448 /regulatory_class="polyA_signal_sequence" /gene="Mfap5" /gene_synonym="MAGP-2; MFAP-5" /note="hexamer: AATAAA" polyA_site 1469 /gene="Mfap5" /gene_synonym="MAGP-2; MFAP-5" ORIGIN
ttagaataggccaaatgtgaagtctttccaagggtgtggctgtgttcatcttattctccagcccaagtagaacagcagagaagcgtgagaaggacggacacactcagcagccagaggccaccggcagacagatcgcagctctgtagacaatatgctgttcttggggcagaaggccttgctgcttgtcttggcaatcagcatcccctctgactggctacccctaggggtcagtggtcaacgcggagatgatgtgcctgagacattcacagacgaccctaatctggtgaacgatccctctacagacgatacagctggtgacaaaaatgctactgcagagtgccgggatgagaagtttgcttgtacaagactgtactctgtccatcggccagtcagacagtgtgtgcaccagtcctgcttcaccagtttacggcgcatgtacatcatcaataatgagatctgttcccgactcgtctgtaaagaacatgaagctatgaaagatgagctttgccggcagatggcaggcctgcctccaaggcgacttcggcgctccaactacttccgacttcctccctgtgaaaatatgaatttgcagagacccgatggtctgtgatcaccaaggaagaaagaagaaaatgtggatgaaggaatcgaaaattctttctcctccaacccctgccatctgtcccgtagacatgtatttttaaactaagccctttgcaatgccccggcttcctaccctactctaattttcactggtgctggtaacgtttgtctcattttgcggtactgacaatacattgtctatattgtggcacgggtttgctgatttctggtgttgtagacaagatggataaaggatggccacttgacttagatacattcagctacattcagctcctgcagtagaaaggggctggggtgcgtggctcagttggcagaaaacttacctaacctttaggttaatattttttttaaatggtgctatgaattgatctcagagcctcgtatataatagtcaatgctctatcactaagctatacccctatctcctaagtagataattttaattattaaatatgccagagacaggagcttgccagaggctcgagccacagagcttccttctagaagtttcctaggttaactcctcattgtttacatatcctctgtactcactttcaccatgcttcgtggcttgtcctaaattttgcccagcaagtcttcatgatgggaaggttgtgggtgaggcaagagagatggctcaatggttaagaacactggatgttcttccagaggacctgggttcagttcccagccagcatccacatggtggctcacaatcacccataagtctagttccagaggacctgagatattttctggcatccatgggcactgcatgcatatgtcacacagacatacatgtggaaaacacacataaaaataaatcactttttaaaaggcaaaaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]