ver.2
Home
|
Help
|
Advanced search
Previous release (v1)
2026-01-17 09:16:30, GGRNA.v2 : RefSeq release 232 (Sep, 2025)
LOCUS NM_001347434 1469 bp mRNA linear ROD 28-APR-2025
DEFINITION Mus musculus microfibrillar associated protein 5 (Mfap5),
transcript variant 2, mRNA.
ACCESSION NM_001347434 XM_006506364
VERSION NM_001347434.1
KEYWORDS RefSeq.
SOURCE Mus musculus (house mouse)
ORGANISM Mus musculus
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
Muroidea; Muridae; Murinae; Mus; Mus.
REFERENCE 1 (bases 1 to 1469)
AUTHORS Chen,Z., Zhao,Q., Chen,L., Gao,S., Meng,L., Liu,Y., Wang,Y., Li,T.
and Xue,J.
TITLE MAGP2 promotes osteogenic differentiation during fracture healing
through its crosstalk with the beta-catenin pathway
JOURNAL J Cell Physiol 239 (4), e31183 (2024)
PUBMED 38348695
REMARK GeneRIF: MAGP2 promotes osteogenic differentiation during fracture
healing through its crosstalk with the beta-catenin pathway.
REFERENCE 2 (bases 1 to 1469)
AUTHORS Jacob,T., Annusver,K., Czarnewski,P., Dalessandri,T., Kalk,C.,
Levra Levron,C., Campama Sanz,N., Kastriti,M.E., Mikkola,M.L.,
Rendl,M., Lichtenberger,B.M., Donati,G., Bjorklund,A.K. and
Kasper,M.
TITLE Molecular and spatial landmarks of early mouse skin development
JOURNAL Dev Cell 58 (20), 2140-2162 (2023)
PUBMED 37591247
REFERENCE 3 (bases 1 to 1469)
AUTHORS Hofling,C., Rossner,S., Flachmeyer,B., Krueger,M., Hartig,W. and
Michalski,D.
TITLE Tricellulin, alpha-Catenin and Microfibrillar-Associated Protein 5
Exhibit Concomitantly Altered Immunosignals along with Vascular,
Extracellular and Cytoskeletal Elements after Experimental Focal
Cerebral Ischemia
JOURNAL Int J Mol Sci 24 (15), 11893 (2023)
PUBMED 37569268
REMARK GeneRIF: Tricellulin, alpha-Catenin and Microfibrillar-Associated
Protein 5 Exhibit Concomitantly Altered Immunosignals along with
Vascular, Extracellular and Cytoskeletal Elements after
Experimental Focal Cerebral Ischemia.
Publication Status: Online-Only
REFERENCE 4 (bases 1 to 1469)
AUTHORS Chen,Z., Zhao,H., Meng,L., Yu,S., Liu,Z. and Xue,J.
TITLE Microfibril-Associated Glycoprotein-2 Promoted Fracture Healing via
Integrin alphavbeta3/PTK2/AKT Signaling
JOURNAL Lab Invest 103 (7), 100121 (2023)
PUBMED 36934797
REMARK GeneRIF: Microfibril-Associated Glycoprotein-2 Promoted Fracture
Healing via Integrin alphavbeta3/PTK2/AKT Signaling.
REFERENCE 5 (bases 1 to 1469)
AUTHORS Han,C., Leonardo,T.R., Romana-Souza,B., Shi,J., Keiser,S., Yuan,H.,
Altakriti,M., Ranzer,M.J., Ferri-Borgogno,S., Mok,S.C., Koh,T.J.,
Hong,S.J., Chen,L. and DiPietro,L.A.
TITLE Microfibril-associated protein 5 and the regulation of skin scar
formation
JOURNAL Sci Rep 13 (1), 8728 (2023)
PUBMED 37253753
REMARK GeneRIF: Microfibril-associated protein 5 and the regulation of
skin scar formation.
Publication Status: Online-Only
REFERENCE 6 (bases 1 to 1469)
AUTHORS Nehring,L.C., Miyamoto,A., Hein,P.W., Weinmaster,G. and
Shipley,J.M.
TITLE The extracellular matrix protein MAGP-2 interacts with Jagged1 and
induces its shedding from the cell surface
JOURNAL J Biol Chem 280 (21), 20349-20355 (2005)
PUBMED 15788413
REFERENCE 7 (bases 1 to 1469)
AUTHORS Lemaire,R., Farina,G., Kissin,E., Shipley,J.M., Bona,C., Korn,J.H.
and Lafyatis,R.
TITLE Mutant fibrillin 1 from tight skin mice increases extracellular
matrix incorporation of microfibril-associated glycoprotein 2 and
type I collagen
JOURNAL Arthritis Rheum 50 (3), 915-926 (2004)
PUBMED 15022335
REMARK GeneRIF: Tight skin fibrillin 1 altered extracellular matrix
organization and caused fibrosis by affecting deposition of MAGP-2
or other fibrillin-1-associated proteins.
REFERENCE 8 (bases 1 to 1469)
AUTHORS Penner,A.S., Rock,M.J., Kielty,C.M. and Shipley,J.M.
TITLE Microfibril-associated glycoprotein-2 interacts with fibrillin-1
and fibrillin-2 suggesting a role for MAGP-2 in elastic fiber
assembly
JOURNAL J Biol Chem 277 (38), 35044-35049 (2002)
PUBMED 12122015
REMARK GeneRIF: interaction with fibrillin-1 and fibrillin-2 suggesting
role in elastic fiber assembly
REFERENCE 9 (bases 1 to 1469)
AUTHORS Shipley,J.M., Mecham,R.P., Maus,E., Bonadio,J., Rosenbloom,J.,
McCarthy,R.T., Baumann,M.L., Frankfater,C., Segade,F. and
Shapiro,S.D.
TITLE Developmental expression of latent transforming growth factor beta
binding protein 2 and its requirement early in mouse development
JOURNAL Mol Cell Biol 20 (13), 4879-4887 (2000)
PUBMED 10848613
REFERENCE 10 (bases 1 to 1469)
AUTHORS Frankfater,C., Maus,E., Gaal,K., Segade,F., Copeland,N.G.,
Gilbert,D.J., Jenkins,N.A. and Shipley,J.M.
TITLE Organization of the mouse microfibril-associated glycoprotein-2
(MAGP-2) gene
JOURNAL Mamm Genome 11 (3), 191-195 (2000)
PUBMED 10723723
COMMENT VALIDATED REFSEQ: This record has undergone validation or
preliminary review. The reference sequence was derived from
AC155946.7.
On Nov 26, 2016 this sequence version replaced XM_006506364.3.
Transcript Variant: This variant (2) lacks an alternate in-frame
exon in the 5' coding region compared to variant 1. It encodes
isoform 2 which is shorter compared to isoform 1.
Sequence Note: The RefSeq transcript and protein were derived from
genomic sequence to make the sequence consistent with the reference
genome assembly. The genomic coordinates used for the transcript
record were based on alignments.
Publication Note: This RefSeq record includes a subset of the
publications that are available for this gene. Please see the Gene
record to access additional publications.
##Evidence-Data-START##
Transcript exon combination :: DV061445.1, ERR3835353.125048.1
[ECO:0000332]
RNAseq introns :: single sample supports all introns
SAMN00849374, SAMN00849375
[ECO:0000348]
##Evidence-Data-END##
COMPLETENESS: complete on the 3' end.
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-149 AC155946.7 121370-121518
150-209 AC155946.7 122127-122186
210-245 AC155946.7 123134-123169
246-278 AC155946.7 128365-128397
279-311 AC155946.7 128682-128714
312-335 AC155946.7 132273-132296
336-423 AC155946.7 133737-133824
424-497 AC155946.7 134573-134646
498-1469 AC155946.7 136105-137076
FEATURES Location/Qualifiers
source 1..1469
/organism="Mus musculus"
/mol_type="mRNA"
/strain="C57BL/6"
/db_xref="taxon:10090"
/chromosome="6"
/map="6 57.61 cM"
gene 1..1469
/gene="Mfap5"
/gene_synonym="MAGP-2; MFAP-5"
/note="microfibrillar associated protein 5"
/db_xref="GeneID:50530"
/db_xref="MGI:MGI:1354387"
exon 1..149
/gene="Mfap5"
/gene_synonym="MAGP-2; MFAP-5"
/inference="alignment:Splign:2.1.0"
misc_feature 86..88
/gene="Mfap5"
/gene_synonym="MAGP-2; MFAP-5"
/note="upstream in-frame stop codon"
exon 150..209
/gene="Mfap5"
/gene_synonym="MAGP-2; MFAP-5"
/inference="alignment:Splign:2.1.0"
CDS 152..610
/gene="Mfap5"
/gene_synonym="MAGP-2; MFAP-5"
/note="isoform 2 precursor is encoded by transcript
variant 2; microfibril-associated glycoprotein 2"
/codon_start=1
/product="microfibrillar-associated protein 5 isoform 2
precursor"
/protein_id="NP_001334363.1"
/db_xref="CCDS:CCDS85155.1"
/db_xref="GeneID:50530"
/db_xref="MGI:MGI:1354387"
/translation="
MLFLGQKALLLVLAISIPSDWLPLGVSGQRGDDVPETFTDDPNLVNDPSTDDTAGDKNATAECRDEKFACTRLYSVHRPVRQCVHQSCFTSLRRMYIINNEICSRLVCKEHEAMKDELCRQMAGLPPRRLRRSNYFRLPPCENMNLQRPDGL"
sig_peptide 152..235
/gene="Mfap5"
/gene_synonym="MAGP-2; MFAP-5"
/inference="COORDINATES: ab initio prediction:SignalP:6.0"
misc_feature 155..517
/gene="Mfap5"
/gene_synonym="MAGP-2; MFAP-5"
/note="Microfibril-associated glycoprotein (MAGP); Region:
MAGP; pfam05507"
/db_xref="CDD:461667"
exon 210..245
/gene="Mfap5"
/gene_synonym="MAGP-2; MFAP-5"
/inference="alignment:Splign:2.1.0"
exon 246..278
/gene="Mfap5"
/gene_synonym="MAGP-2; MFAP-5"
/inference="alignment:Splign:2.1.0"
exon 279..311
/gene="Mfap5"
/gene_synonym="MAGP-2; MFAP-5"
/inference="alignment:Splign:2.1.0"
exon 312..335
/gene="Mfap5"
/gene_synonym="MAGP-2; MFAP-5"
/inference="alignment:Splign:2.1.0"
exon 336..423
/gene="Mfap5"
/gene_synonym="MAGP-2; MFAP-5"
/inference="alignment:Splign:2.1.0"
exon 424..497
/gene="Mfap5"
/gene_synonym="MAGP-2; MFAP-5"
/inference="alignment:Splign:2.1.0"
exon 498..1469
/gene="Mfap5"
/gene_synonym="MAGP-2; MFAP-5"
/inference="alignment:Splign:2.1.0"
regulatory 792..797
/regulatory_class="polyA_signal_sequence"
/gene="Mfap5"
/gene_synonym="MAGP-2; MFAP-5"
/note="hexamer: AATACA"
polyA_site 814
/gene="Mfap5"
/gene_synonym="MAGP-2; MFAP-5"
/note="major polyA site"
regulatory 1443..1448
/regulatory_class="polyA_signal_sequence"
/gene="Mfap5"
/gene_synonym="MAGP-2; MFAP-5"
/note="hexamer: AATAAA"
polyA_site 1469
/gene="Mfap5"
/gene_synonym="MAGP-2; MFAP-5"
ORIGIN
ttagaataggccaaatgtgaagtctttccaagggtgtggctgtgttcatcttattctccagcccaagtagaacagcagagaagcgtgagaaggacggacacactcagcagccagaggccaccggcagacagatcgcagctctgtagacaatatgctgttcttggggcagaaggccttgctgcttgtcttggcaatcagcatcccctctgactggctacccctaggggtcagtggtcaacgcggagatgatgtgcctgagacattcacagacgaccctaatctggtgaacgatccctctacagacgatacagctggtgacaaaaatgctactgcagagtgccgggatgagaagtttgcttgtacaagactgtactctgtccatcggccagtcagacagtgtgtgcaccagtcctgcttcaccagtttacggcgcatgtacatcatcaataatgagatctgttcccgactcgtctgtaaagaacatgaagctatgaaagatgagctttgccggcagatggcaggcctgcctccaaggcgacttcggcgctccaactacttccgacttcctccctgtgaaaatatgaatttgcagagacccgatggtctgtgatcaccaaggaagaaagaagaaaatgtggatgaaggaatcgaaaattctttctcctccaacccctgccatctgtcccgtagacatgtatttttaaactaagccctttgcaatgccccggcttcctaccctactctaattttcactggtgctggtaacgtttgtctcattttgcggtactgacaatacattgtctatattgtggcacgggtttgctgatttctggtgttgtagacaagatggataaaggatggccacttgacttagatacattcagctacattcagctcctgcagtagaaaggggctggggtgcgtggctcagttggcagaaaacttacctaacctttaggttaatattttttttaaatggtgctatgaattgatctcagagcctcgtatataatagtcaatgctctatcactaagctatacccctatctcctaagtagataattttaattattaaatatgccagagacaggagcttgccagaggctcgagccacagagcttccttctagaagtttcctaggttaactcctcattgtttacatatcctctgtactcactttcaccatgcttcgtggcttgtcctaaattttgcccagcaagtcttcatgatgggaaggttgtgggtgaggcaagagagatggctcaatggttaagaacactggatgttcttccagaggacctgggttcagttcccagccagcatccacatggtggctcacaatcacccataagtctagttccagaggacctgagatattttctggcatccatgggcactgcatgcatatgtcacacagacatacatgtggaaaacacacataaaaataaatcactttttaaaaggcaaaaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]