ver.2
Home
|
Help
|
Advanced search
Previous release (v1)
2026-04-25 00:06:39, GGRNA.v2 : RefSeq release 233 (Jan, 2026)
LOCUS NM_001291481 829 bp mRNA linear ROD 29-JUL-2025
DEFINITION Mus musculus midkine (Mdk), transcript variant 4, mRNA.
ACCESSION NM_001291481 XM_006498858
VERSION NM_001291481.2
KEYWORDS RefSeq.
SOURCE Mus musculus (house mouse)
ORGANISM Mus musculus
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
Muroidea; Muridae; Murinae; Mus; Mus.
REFERENCE 1 (bases 1 to 829)
AUTHORS Guo,J., Zheng,J., Li,R., Yao,J., Zhang,H., Wang,X. and Zhang,C.
TITLE Single-cell transcriptome analysis reveals abnormal angiogenesis
and placentation by loss of imprinted glutaminyl-peptide
cyclotransferase
JOURNAL J Zhejiang Univ Sci B 26 (6), 589-608 (2025)
PUBMED 40571662
REFERENCE 2 (bases 1 to 829)
AUTHORS Zhu,Z., Zou,Q., Wang,C., Li,D., Yang,Y., Xiao,Y., Jin,Y., Yan,J.,
Luo,L., Sun,Y. and Liang,X.
TITLE Isl Identifies the Extraembryonic Mesodermal/Allantois Progenitors
and is Required for Placenta Morphogenesis and Vasculature
Formation
JOURNAL Adv Sci (Weinh) 11 (32), e2400238 (2024)
PUBMED 38923264
REFERENCE 3 (bases 1 to 829)
AUTHORS Xu,C., Chen,J., Liang,L., Chen,S., Niu,X., Sang,R., Yang,C. and
Rong,R.
TITLE Midkine promotes renal fibrosis by stabilizing C/EBPbeta to
facilitate endothelial-mesenchymal transition
JOURNAL Commun Biol 7 (1), 544 (2024)
PUBMED 38714800
REMARK Publication Status: Online-Only
REFERENCE 4 (bases 1 to 829)
AUTHORS Inoh,K., Muramatsu,H., Ochiai,K., Torii,S. and Muramatsu,T.
TITLE Midkine, a heparin-binding cytokine, plays key roles in
intraperitoneal adhesions
JOURNAL Biochem Biophys Res Commun 317 (1), 108-113 (2004)
PUBMED 15047154
REFERENCE 5 (bases 1 to 829)
AUTHORS Naito,A., Yoshikura,H. and Iwamoto,A.
TITLE Similarity of the genomic structure between the two members in a
new family of heparin-binding factors
JOURNAL Biochem Biophys Res Commun 183 (2), 701-707 (1992)
PUBMED 1550576
REFERENCE 6 (bases 1 to 829)
AUTHORS Haas,I.G., Simon-Chazottes,D. and Guenet,J.L.
TITLE The gene coding for the immunoglobulin heavy chain binding protein
BiP (Hsce-70) maps to mouse chromosome 2
JOURNAL Mamm Genome 3 (11), 659-660 (1992)
PUBMED 1450517
REFERENCE 7 (bases 1 to 829)
AUTHORS Simon-Chazottes,D., Matsubara,S., Miyauchi,T., Muramatsu,T. and
Guenet,J.L.
TITLE Chromosomal localization of two cell surface-associated molecules
of potential importance in development: midkine (Mdk) and basigin
(Bsg)
JOURNAL Mamm Genome 2 (4), 269-271 (1992)
PUBMED 1347477
REFERENCE 8 (bases 1 to 829)
AUTHORS Tomomura,M., Kadomatsu,K., Matsubara,S. and Muramatsu,T.
TITLE A retinoic acid-responsive gene, MK, found in the teratocarcinoma
system. Heterogeneity of the transcript and the nature of the
translation product
JOURNAL J Biol Chem 265 (18), 10765-10770 (1990)
PUBMED 2355021
REFERENCE 9 (bases 1 to 829)
AUTHORS Matsubara,S., Tomomura,M., Kadomatsu,K. and Muramatsu,T.
TITLE Structure of a retinoic acid-responsive gene, MK, which is
transiently activated during the differentiation of embryonal
carcinoma cells and the mid-gestation period of mouse embryogenesis
JOURNAL J Biol Chem 265 (16), 9441-9443 (1990)
PUBMED 2345177
REFERENCE 10 (bases 1 to 829)
AUTHORS Kadomatsu,K., Tomomura,M. and Muramatsu,T.
TITLE cDNA cloning and sequencing of a new gene intensely expressed in
early differentiation stages of embryonal carcinoma cells and in
mid-gestation period of mouse embryogenesis
JOURNAL Biochem Biophys Res Commun 151 (3), 1312-1318 (1988)
PUBMED 3355557
COMMENT VALIDATED REFSEQ: This record has undergone validation or
preliminary review. The reference sequence was derived from
AL731772.9.
On Oct 27, 2022 this sequence version replaced NM_001291481.1.
Summary: This gene encodes a secreted growth factor that belongs to
the pleiotrophin/midkine heparin-binding protein family and
functions in a variety of biological processes. The encoded
cytokine promotes the growth, differentiation, survival and
migration of several target cells including leucocytes involved in
inflammation. This protein plays a role in the formation of scar
tissue and intraperitoneal adhesions, and promotes neurite
outgrowth and neuron survival. The protein encoded by this gene is
associated with obesity and inhibition of insulin signaling in fat
cells. A pseudogene of this gene is present on chromosome 11.
Alternative splicing results in multiple transcript variants.
[provided by RefSeq, Apr 2014].
Publication Note: This RefSeq record includes a subset of the
publications that are available for this gene. Please see the Gene
record to access additional publications.
##Evidence-Data-START##
Transcript exon combination :: CF728526.1, AV570726.1 [ECO:0000332]
RNAseq introns :: single sample supports all introns
SAMN01164137, SAMN01164138
[ECO:0000348]
##Evidence-Data-END##
COMPLETENESS: full length.
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-119 AL731772.9 69238-69356 c
120-196 AL731772.9 68983-69059 c
197-355 AL731772.9 68707-68865 c
356-517 AL731772.9 68429-68590 c
518-829 AL731772.9 67415-67726 c
FEATURES Location/Qualifiers
source 1..829
/organism="Mus musculus"
/mol_type="mRNA"
/strain="C57BL/6"
/db_xref="taxon:10090"
/chromosome="2"
/map="2 50.63 cM"
gene 1..829
/gene="Mdk"
/gene_synonym="Mek; MK"
/note="midkine"
/db_xref="GeneID:17242"
/db_xref="MGI:MGI:96949"
exon 1..119
/gene="Mdk"
/gene_synonym="Mek; MK"
/inference="alignment:Splign:2.1.0"
misc_feature 46..48
/gene="Mdk"
/gene_synonym="Mek; MK"
/note="upstream in-frame stop codon"
exon 120..196
/gene="Mdk"
/gene_synonym="Mek; MK"
/inference="alignment:Splign:2.1.0"
CDS 121..543
/gene="Mdk"
/gene_synonym="Mek; MK"
/note="isoform a precursor is encoded by transcript
variant 4; retinoic acid-induced differentiation factor;
retinoic acid-responsive protein; retanoic acid-responsive
protein"
/codon_start=1
/product="midkine isoform a precursor"
/protein_id="NP_001278410.1"
/db_xref="CCDS:CCDS16440.1"
/db_xref="GeneID:17242"
/db_xref="MGI:MGI:96949"
/translation="
MQHRGFFLLALLALLVVTSAVAKKKEKVKKGSECSEWTWGPCTPSSKDCGMGFREGTCGAQTQRVHCKVPCNWKKEFGADCKYKFESWGACDGSTGTKARQGTLKKARYNAQCQETIRVTKPCTSKTKSKTKAKKGKGKD"
sig_peptide 121..186
/gene="Mdk"
/gene_synonym="Mek; MK"
/inference="COORDINATES: ab initio prediction:SignalP:6.0"
mat_peptide 187..540
/gene="Mdk"
/gene_synonym="Mek; MK"
/product="Midkine. /id=PRO_0000024663"
/note="propagated from UniProtKB/Swiss-Prot (P12025.2)"
misc_feature 220..459
/gene="Mdk"
/gene_synonym="Mek; MK"
/note="Pleiotrophin / midkine family; Region: PTN;
smart00193"
/db_xref="CDD:128490"
misc_feature 418..420
/gene="Mdk"
/gene_synonym="Mek; MK"
/note="Required for high affinity binding to PTRZ1 by
interacting with the chondroitin sulfate chains of PTRZ1.
/evidence=ECO:0000269|PubMed:10212223; propagated from
UniProtKB/Swiss-Prot (P12025.2); other site"
exon 197..355
/gene="Mdk"
/gene_synonym="Mek; MK"
/inference="alignment:Splign:2.1.0"
exon 356..517
/gene="Mdk"
/gene_synonym="Mek; MK"
/inference="alignment:Splign:2.1.0"
exon 518..829
/gene="Mdk"
/gene_synonym="Mek; MK"
/inference="alignment:Splign:2.1.0"
regulatory 782..787
/regulatory_class="polyA_signal_sequence"
/gene="Mdk"
/gene_synonym="Mek; MK"
/note="hexamer: AATAAA"
regulatory 787..792
/regulatory_class="polyA_signal_sequence"
/gene="Mdk"
/gene_synonym="Mek; MK"
/note="hexamer: AATAAA"
polyA_site 804
/gene="Mdk"
/gene_synonym="Mek; MK"
regulatory 806..811
/regulatory_class="polyA_signal_sequence"
/gene="Mdk"
/gene_synonym="Mek; MK"
/note="hexamer: AATAAA"
polyA_site 807
/gene="Mdk"
/gene_synonym="Mek; MK"
/note="major polyA site"
polyA_site 829
/gene="Mdk"
/gene_synonym="Mek; MK"
ORIGIN
cttagcgggacaggccggagcgggagggagcgaagcatcgagcagtgagcgagtgagcgcacgcagtggctgtggccccagtcccttcaggcggctgctctgccaccaagggggctgaggatgcagcaccgaggcttcttccttctcgcccttcttgccctcttggtggtcacgtccgcggtggccaaaaaaaaagagaaggtgaagaagggcagcgagtgttcggagtggacctgggggccctgcacccccagcagcaaggactgcggcatgggcttccgcgagggtacctgtggggcccagacccagcgcgtccattgcaaggtgccctgcaactggaagaaggaatttggagccgactgcaaatacaagtttgagagctggggggcgtgtgatgggagcactggcaccaaagcccgccaagggaccctgaagaaggcgcggtacaatgcccagtgccaggagaccatccgcgtgactaagccctgcacctccaagaccaagtcaaagaccaaagccaagaaaggaaaaggaaaggactaagtcaggaggccagagagcctccggcctcgcctggagcctgaacggagccctcctctcccacaggcccaagatataacccaccagtgccttttgtcttcctgtcagctctgtcaatcacgcctgtcctctcacgcccacaccaagtgcccaaagtggggagggacaagagattctggaaagtgagcctccccataccctcttttgttctccccaccctgatacttgttattaagaaatgaataaaataaactcacttttttccaataaaagcttcttttttaatata
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]