LOCUS       NM_001252260            1401 bp    mRNA    linear   ROD 24-DEC-2024
DEFINITION  Mus musculus nucleophosmin 1 (Npm1), transcript variant 2, mRNA.
ACCESSION   NM_001252260
VERSION     NM_001252260.1
KEYWORDS    RefSeq.
SOURCE      Mus musculus (house mouse)
  ORGANISM  Mus musculus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Mus; Mus.
REFERENCE   1  (bases 1 to 1401)
  AUTHORS   Bowman,R.L., Dunbar,A.J., Mishra,T., Xiao,W., Waarts,M.R.,
            Maestre,I.F., Eisman,S.E., Cai,L., Mowla,S., Shah,N., Youn,A.,
            Bennett,L., Fontenard,S., Gounder,S., Gandhi,A., Bowman,M.,
            O'Connor,K., Zaroogian,Z., Sanchez-Vela,P., Martinez Benitez,A.R.,
            Werewski,M., Park,Y., Csete,I.S., Krishnan,A., Lee,D., Boorady,N.,
            Potts,C.R., Jenkins,M.T., Cai,S.F., Carroll,M.P., Meyer,S.E.,
            Miles,L.A., Ferrell,P.B. Jr., Trowbridge,J.J. and Levine,R.L.
  TITLE     In vivo models of subclonal oncogenesis and dependency in
            hematopoietic malignancy
  JOURNAL   Cancer Cell 42 (11), 1955-1969 (2024)
   PUBMED   39532065
REFERENCE   2  (bases 1 to 1401)
  AUTHORS   Zhang,S., Zhang,Y., Duan,X., Wang,B. and Zhan,Z.
  TITLE     Targeting NPM1 Epigenetically Promotes Postinfarction Cardiac
            Repair by Reprogramming Reparative Macrophage Metabolism
  JOURNAL   Circulation 149 (25), 1982-2001 (2024)
   PUBMED   38390737
  REMARK    GeneRIF: Targeting NPM1 Epigenetically Promotes Postinfarction
            Cardiac Repair by Reprogramming Reparative Macrophage Metabolism.
REFERENCE   3  (bases 1 to 1401)
  AUTHORS   Korai,A., Lin,X., Tago,K. and Funakoshi-Tago,M.
  TITLE     The acetylation of STAT3 at K685 attenuates NPM-ALK-induced
            tumorigenesis
  JOURNAL   Cell Signal 114, 110985 (2024)
   PUBMED   38000524
  REMARK    GeneRIF: The acetylation of STAT3 at K685 attenuates
            NPM-ALK-induced tumorigenesis.
REFERENCE   4  (bases 1 to 1401)
  AUTHORS   Fang,Y., Zhang,J., Zhu,D., Mei,Q., Liao,T., Cheng,H., He,Y., Cao,Y.
            and Wei,Z.
  TITLE     MANF Promotes Unexplained Recurrent Miscarriages by Interacting
            with NPM1 and Downregulating Trophoblast Cell Migration and
            Invasion
  JOURNAL   Int J Biol Sci 20 (1), 296-311 (2024)
   PUBMED   38164189
  REMARK    GeneRIF: MANF Promotes Unexplained Recurrent Miscarriages by
            Interacting with NPM1 and Downregulating Trophoblast Cell Migration
            and Invasion.
            Publication Status: Online-Only
REFERENCE   5  (bases 1 to 1401)
  AUTHORS   Izzo,A., Akol,I., Villarreal,A., Lebel,S., Garcia-Miralles,M.,
            Cheffer,A., Bovio,P., Heidrich,S. and Vogel,T.
  TITLE     Nucleophosmin 1 cooperates with the methyltransferase DOT1L to
            preserve peri-nucleolar heterochromatin organization by regulating
            H3K27me3 levels and DNA repeats expression
  JOURNAL   Epigenetics Chromatin 16 (1), 36 (2023)
   PUBMED   37759327
  REMARK    GeneRIF: Nucleophosmin 1 cooperates with the methyltransferase
            DOT1L to preserve peri-nucleolar heterochromatin organization by
            regulating H3K27me3 levels and DNA repeats expression.
            Publication Status: Online-Only
REFERENCE   6  (bases 1 to 1401)
  AUTHORS   Sowden,J.C., Morrison,K., Putt,W., Beddington,R. and Edwards,Y.H.
  TITLE     The identification of novel sequences expressed in the mouse
            notochord
  JOURNAL   Mamm Genome 8 (1), 42-44 (1997)
   PUBMED   9021147
REFERENCE   7  (bases 1 to 1401)
  AUTHORS   Inouye,C.J. and Seto,E.
  TITLE     Relief of YY1-induced transcriptional repression by protein-protein
            interaction with the nucleolar phosphoprotein B23
  JOURNAL   J Biol Chem 269 (9), 6506-6510 (1994)
   PUBMED   8120001
REFERENCE   8  (bases 1 to 1401)
  AUTHORS   Van den Eynde,B., Lethe,B., Van Pel,A., De Plaen,E. and Boon,T.
  TITLE     The gene coding for a major tumor rejection antigen of tumor P815
            is identical to the normal gene of syngeneic DBA/2 mice
  JOURNAL   J Exp Med 173 (6), 1373-1384 (1991)
   PUBMED   1903428
REFERENCE   9  (bases 1 to 1401)
  AUTHORS   Biggiogera,M., Burki,K., Kaufmann,S.H., Shaper,J.H., Gas,N.,
            Amalric,F. and Fakan,S.
  TITLE     Nucleolar distribution of proteins B23 and nucleolin in mouse
            preimplantation embryos as visualized by immunoelectron microscopy
  JOURNAL   Development 110 (4), 1263-1270 (1990)
   PUBMED   2100262
REFERENCE   10 (bases 1 to 1401)
  AUTHORS   Schmidt-Zachmann,M.S. and Franke,W.W.
  TITLE     DNA cloning and amino acid sequence determination of a major
            constituent protein of mammalian nucleoli. Correspondence of the
            nucleoplasmin-related protein NO38 to mammalian protein B23
  JOURNAL   Chromosoma 96 (6), 417-426 (1988)
   PUBMED   3219912
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            CA540276.1, BU513690.1, BC089546.1 and CX567338.1.
            
            Transcript Variant: This variant (2) lacks an in-frame segment in
            the 5' coding region, compared to variant 1. The resulting isoform
            (2) lacks an internal segment, compared to isoform 1.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: SRR17784646.1017816.1 [ECO:0000332]
            RNAseq introns              :: mixed sample support SAMN00849374,
                                           SAMN00849375 [ECO:0006172]
            ##Evidence-Data-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-144               CA540276.1         1-144
            145-622             BU513690.1         1-478
            623-748             BU513690.1         480-605
            749-1307            BC089546.1         658-1216
            1308-1401           CX567338.1         632-725
FEATURES             Location/Qualifiers
     source          1..1401
                     /organism="Mus musculus"
                     /mol_type="mRNA"
                     /strain="C57BL/6"
                     /db_xref="taxon:10090"
                     /chromosome="11"
                     /map="11 19.21 cM"
     gene            1..1401
                     /gene="Npm1"
                     /gene_synonym="B23; NO38; Npm"
                     /note="nucleophosmin 1"
                     /db_xref="GeneID:18148"
                     /db_xref="MGI:MGI:106184"
     exon            1..285
                     /gene="Npm1"
                     /gene_synonym="B23; NO38; Npm"
                     /inference="alignment:Splign:2.1.0"
     CDS             228..1067
                     /gene="Npm1"
                     /gene_synonym="B23; NO38; Npm"
                     /note="isoform 2 is encoded by transcript variant 2;
                     numatrin; nucleolar phosphoprotein B23; nucleolar protein
                     NO38"
                     /codon_start=1
                     /product="nucleophosmin isoform 2"
                     /protein_id="NP_001239189.1"
                     /db_xref="GeneID:18148"
                     /db_xref="MGI:MGI:106184"
                     /translation="

MEDSMDMDMSPLRPQNYLFVDNDENEHQLSLRTVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVEEDAESEDEDEEDVKLLGMSGKRSAPGGGNKVPQKKVKLDEDDEDDDEDDEDDEDDDDDDFDEEETEEKVPVKKSVRDTPAKNAQKSNQNGKDLKPSTPRSKGQESFKKQEKTPKTPKGPSSVEDIKAKMQASIEKGGSLPKVEAKFINYVKNCFRMTDQEAIQDLWQWRKSL"

     misc_feature    288..539
                     /gene="Npm1"
                     /gene_synonym="B23; NO38; Npm"
                     /note="Nucleoplasmin/nucleophosmin domain; Region:
                     Nucleoplasmin; pfam03066"
                     /db_xref="CDD:460792"
     misc_feature    915..1061
                     /gene="Npm1"
                     /gene_synonym="B23; NO38; Npm"
                     /note="Nucleophosmin C-terminal domain; Region: NPM1-C;
                     pfam16276"
                     /db_xref="CDD:465081"
     exon            286..326
                     /gene="Npm1"
                     /gene_synonym="B23; NO38; Npm"
                     /inference="alignment:Splign:2.1.0"
     exon            327..446
                     /gene="Npm1"
                     /gene_synonym="B23; NO38; Npm"
                     /inference="alignment:Splign:2.1.0"
     exon            447..540
                     /gene="Npm1"
                     /gene_synonym="B23; NO38; Npm"
                     /inference="alignment:Splign:2.1.0"
     exon            541..647
                     /gene="Npm1"
                     /gene_synonym="B23; NO38; Npm"
                     /inference="alignment:Splign:2.1.0"
     exon            648..709
                     /gene="Npm1"
                     /gene_synonym="B23; NO38; Npm"
                     /inference="alignment:Splign:2.1.0"
     exon            710..767
                     /gene="Npm1"
                     /gene_synonym="B23; NO38; Npm"
                     /inference="alignment:Splign:2.1.0"
     exon            768..851
                     /gene="Npm1"
                     /gene_synonym="B23; NO38; Npm"
                     /inference="alignment:Splign:2.1.0"
     exon            852..953
                     /gene="Npm1"
                     /gene_synonym="B23; NO38; Npm"
                     /inference="alignment:Splign:2.1.0"
     exon            954..1028
                     /gene="Npm1"
                     /gene_synonym="B23; NO38; Npm"
                     /inference="alignment:Splign:2.1.0"
     exon            1029..1383
                     /gene="Npm1"
                     /gene_synonym="B23; NO38; Npm"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      

ggcgcacgcgcaaaagcgcgactgtgcggggagtgggagggatccagaggaggctcgcggaggcaggactagcgcagatctcgcgagatctcctgcgaccatatatacgtgcggagagcccgcgtcctttccttggcgtgattccgtcctgcgcgtctgttctgtggaacaggaggcagttgttttccgtccggcttctcccacaccgaagtgcgcgcctccacctcatggaagactcgatggatatggacatgagtcctcttaggcctcagaactaccttttcgtggataatgatgaaaatgagcaccagttgtcattaagaacggtcagtttaggagcaggggcaaaagatgagttacacatcgtagaggcagaagcaatgaactatgaaggcagtccaattaaagtaacactggcaactttgaaaatgtctgtacaaccaacagtttccctagggggctttgaaattacaccacctgtggtcttacggttgaagtgtggttcagggcctgtgcacattagtggacagcatctagtagctgtagaggaagatgcagagtctgaagatgaagatgaggaggacgtaaaactcttaggcatgtctggaaagcgatctgctcctggaggtggtaacaaggttccacagaaaaaagtaaaacttgatgaagatgatgaggacgatgatgaggacgatgaggatgatgaggatgatgatgatgatgattttgatgaagaggaaactgaagaaaaggtcccagtgaagaaatctgtacgagataccccagccaaaaatgcacaaaaatcaaaccaaaatggaaaagacttaaaaccatcaacaccgagatcaaagggtcaagagtccttcaaaaaacaggaaaagactcctaaaacaccaaaaggacctagttctgtagaagacattaaggcaaaaatgcaagcaagtatagaaaaaggcggttctcttcccaaagtggaagccaagttcattaattatgtgaagaattgtttccggatgactgaccaggaggctattcaagatctctggcagtggaggaaatctctttaagaaaagggtttaaacagtttgaaatattctgtcttcatttctgtaatagttaatatctggctgtcctttttataatgcaaagtgagaactttccctactgtgtttgataaatgttgtccaggttcacttgccaagaatgtgttgtctaaaatgcctgtttagttttcaaggatggaactccaccctttacttggttttaagtatgtatggaatgttatgataggacatagtaatagtggtcagatgtggaaatggtagggagacaaatatacatgtgaaataaactcagtattttaataaagtagcactgtttctaaaaaaaaaaaaaaaaaaa

//