ver.2
Home
|
Help
|
Advanced search
Previous release (v1)
2026-06-24 23:29:35, GGRNA.v2 : RefSeq release 233 (Jan, 2026)
LOCUS NM_001160097 1092 bp mRNA linear ROD 14-NOV-2025 DEFINITION Mus musculus claudin 10 (Cldn10), transcript variant a_v2, mRNA. ACCESSION NM_001160097 VERSION NM_001160097.1 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE 1 (bases 1 to 1092) AUTHORS Jasmine, Samtiya,M., Rodrigues,R., Mandal,A., Kavya,T.T., Anushree,A., Lafin,J.T., Vezina,C.M., Strand,D.W. and Binoy Joseph,D. TITLE Single cell map of the adult female mouse urethra reveals epithelial and stromal macrophages with distinct functional identities JOURNAL Mucosal Immunol (2025) In press PUBMED 40907791 REMARK Publication Status: Available-Online prior to print REFERENCE 2 (bases 1 to 1092) AUTHORS Lamprou,A., Porcheri,C. and Mitsiadis,T.A. TITLE Notch2 Deletion Compromises Epithelial Integrity and Enamel Formation in Rodent Incisors JOURNAL Cells 14 (15), 1224 (2025) PUBMED 40801656 REMARK Publication Status: Online-Only REFERENCE 3 (bases 1 to 1092) AUTHORS Patel,V.N., Aure,M.H., Choi,S.H., Ball,J.R., Lane,E.D., Wang,Z., Xu,Y., Zheng,C., Liu,X., Martin,D., Pailin,J.Y., Prochazkova,M., Kulkarni,A.B., van Kuppevelt,T.H., Ambudkar,I.S., Liu,J. and Hoffman,M.P. TITLE Specific 3-O-sulfated heparan sulfate domains regulate salivary gland basement membrane metabolism and epithelial differentiation JOURNAL Nat Commun 15 (1), 7584 (2024) PUBMED 39217171 REMARK Erratum:[Nat Commun. 2024 Oct 10;15(1):8784. doi: 10.1038/s41467-024-53230-4. PMID: 39389981] Publication Status: Online-Only REFERENCE 4 (bases 1 to 1092) AUTHORS Brideau,G., Cheval,L., Griveau,C., Ling,W.E., Lievre,L., Crambert,G., Muller,D., Brocic,J., Cherchame,E., Houillier,P. and Prot-Bertoye,C. TITLE Claudin-10 Expression and the Gene Expression Pattern of Thick Ascending Limb Cells JOURNAL Int J Mol Sci 25 (7), 4008 (2024) PUBMED 38612818 REMARK GeneRIF: Claudin-10 Expression and the Gene Expression Pattern of Thick Ascending Limb Cells. Publication Status: Online-Only REFERENCE 5 (bases 1 to 1092) AUTHORS Aure,M.H., Symonds,J.M., Villapudua,C.U., Dodge,J.T., Werner,S., Knosp,W.M. and Hoffman,M.P. TITLE FGFR2 is essential for salivary gland duct homeostasis and MAPK-dependent seromucous acinar cell differentiation JOURNAL Nat Commun 14 (1), 6485 (2023) PUBMED 37838739 REMARK Publication Status: Online-Only REFERENCE 6 (bases 1 to 1092) AUTHORS Kitajiri,S.I., Furuse,M., Morita,K., Saishin-Kiuchi,Y., Kido,H., Ito,J. and Tsukita,S. TITLE Expression patterns of claudins, tight junction adhesion molecules, in the inner ear JOURNAL Hear Res 187 (1-2), 25-34 (2004) PUBMED 14698084 REMARK GeneRIF: Claudin-10 is expressed at the variety of epithelial tissues in the coclea of inner ear including Organ of Corti, stria vascularis, Reissner's membrane, and spiral limbus. REFERENCE 7 (bases 1 to 1092) AUTHORS VanBuren,V., Piao,Y., Dudekula,D.B., Qian,Y., Carter,M.G., Martin,P.R., Stagg,C.A., Bassey,U.C., Aiba,K., Hamatani,T., Kargul,G.J., Luo,A.G., Kelso,J., Hide,W. and Ko,M.S. TITLE Assembly, verification, and initial annotation of the NIA mouse 7.4K cDNA clone set JOURNAL Genome Res 12 (12), 1999-2003 (2002) PUBMED 12466305 REFERENCE 8 (bases 1 to 1092) AUTHORS Turksen,K. and Troy,T.C. TITLE Permeability barrier dysfunction in transgenic mice overexpressing claudin 6 JOURNAL Development 129 (7), 1775-1784 (2002) PUBMED 11923212 REFERENCE 9 (bases 1 to 1092) AUTHORS Niimi,T., Nagashima,K., Ward,J.M., Minoo,P., Zimonjic,D.B., Popescu,N.C. and Kimura,S. TITLE claudin-18, a novel downstream target gene for the T/EBP/NKX2.1 homeodomain transcription factor, encodes lung- and stomach-specific isoforms through alternative splicing JOURNAL Mol Cell Biol 21 (21), 7380-7390 (2001) PUBMED 11585919 REFERENCE 10 (bases 1 to 1092) AUTHORS Morita,K., Sasaki,H., Fujimoto,K., Furuse,M. and Tsukita,S. TITLE Claudin-11/OSP-based tight junctions of myelin sheaths in brain and Sertoli cells in testis JOURNAL J Cell Biol 145 (3), 579-588 (1999) PUBMED 10225958 COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from CA467408.1, AK020131.1, CK332009.1 and AI851016.1. Summary: This intronless gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight unction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in maintaining cell polarity and signal transductions. Six alternatively spliced transcript variants have been identified, which encode different isoforms with distinct electric charge of the first extracellular loop and with or without the fourth transmembrane region. These isoforms exhibit distinct localization and function in paracellular anion or cation permeability. [provided by RefSeq, Aug 2010]. Transcript Variant: This variant (a_v2) lacks an alternate in-frame exon in the 3' coding region, compared to variant a. The resulting isoform (a_i2) lacks an internal segment including the entire fourth transmembrane region, compared to isoform a. This variant is expressed only in kidney and uterus. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: BC021770.1 [ECO:0000332] RNAseq introns :: mixed sample support SAMN00849374, SAMN00849375 [ECO:0006172] ##Evidence-Data-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-37 CA467408.1 38-74 38-589 AK020131.1 2-553 590-744 CK332009.1 155-309 745-1092 AI851016.1 1-348 c FEATURES Location/Qualifiers source 1..1092 /organism="Mus musculus" /mol_type="mRNA" /strain="C57BL/6" /db_xref="taxon:10090" /chromosome="14" /map="14 62.55 cM" gene 1..1092 /gene="Cldn10" /gene_synonym="6720456I16Rik; Cldn10a; Cldn10b; D14Ertd728e" /note="claudin 10" /db_xref="GeneID:58187" /db_xref="MGI:MGI:1913101" exon 1..500 /gene="Cldn10" /gene_synonym="6720456I16Rik; Cldn10a; Cldn10b; D14Ertd728e" /inference="alignment:Splign:2.1.0" misc_feature 197..199 /gene="Cldn10" /gene_synonym="6720456I16Rik; Cldn10a; Cldn10b; D14Ertd728e" /note="upstream in-frame stop codon" CDS 287..868 /gene="Cldn10" /gene_synonym="6720456I16Rik; Cldn10a; Cldn10b; D14Ertd728e" /note="isoform a_i2 is encoded by transcript variant a_v2; claudin-10A; claudin 10B" /codon_start=1 /product="claudin-10 isoform a_i2" /protein_id="NP_001153569.1" /db_xref="CCDS:CCDS49566.1" /db_xref="GeneID:58187" /db_xref="MGI:MGI:1913101" /translation="
MSRAQISALVCGVGGFGALVAATTSNEWKVTTRASSVITATWVYQGLWMNCAGNALGSFHCRPHFTIFKVEGYIQACRGLMIAAVSLGFFGSIFALFGMKCTKVGGSDQAKAKIACLAGIVFILSGLCSMTGCSLYANKITTEFFDPLYMEQKMGYTYNGPTSAMSSRTKYQGGEGDFKTTGPSKQFDKNAYV"
misc_feature 311..760
/gene="Cldn10"
/gene_synonym="6720456I16Rik; Cldn10a; Cldn10b;
D14Ertd728e"
/note="PMP-22/EMP/MP20/Claudin family; Region:
PMP22_Claudin; cl21598"
/db_xref="CDD:473919"
exon 501..662
/gene="Cldn10"
/gene_synonym="6720456I16Rik; Cldn10a; Cldn10b;
D14Ertd728e"
/inference="alignment:Splign:2.1.0"
exon 663..744
/gene="Cldn10"
/gene_synonym="6720456I16Rik; Cldn10a; Cldn10b;
D14Ertd728e"
/inference="alignment:Splign:2.1.0"
exon 745..1078
/gene="Cldn10"
/gene_synonym="6720456I16Rik; Cldn10a; Cldn10b;
D14Ertd728e"
/inference="alignment:Splign:2.1.0"
regulatory 976..981
/regulatory_class="polyA_signal_sequence"
/gene="Cldn10"
/gene_synonym="6720456I16Rik; Cldn10a; Cldn10b;
D14Ertd728e"
/note="hexamer: TATAAA"
polyA_site 996
/gene="Cldn10"
/gene_synonym="6720456I16Rik; Cldn10a; Cldn10b;
D14Ertd728e"
regulatory 1060..1065
/regulatory_class="polyA_signal_sequence"
/gene="Cldn10"
/gene_synonym="6720456I16Rik; Cldn10a; Cldn10b;
D14Ertd728e"
/note="hexamer: AATAAA"
polyA_site 1078
/gene="Cldn10"
/gene_synonym="6720456I16Rik; Cldn10a; Cldn10b;
D14Ertd728e"
/note="major polyA site"
ORIGIN
aacaagagaaaaaaatatctgcagtaccaacaccttcaagattcctctacaaagttttggtatttcagtagggaattagaaagattattctaagctatctctaagatgcccttagtgtgatatactttattctaatttcccacacttcaagccatgagattatgaagaattgtcacctaccctcatgggctggctttaacattcgtggaagttttgtccagtgtctgcatgcctaggccaccaaagccttctgtgtggactgtggcagcaggcaaggctgagcgacatgtccagggcacagatctcagctctggtgtgtggtgttggagggtttggtgctctcgtcgctgccaccacatccaacgaatggaaagtgaccacccgagcgtcgtctgtgattaccgccacctgggtttaccagggtctgtggatgaactgcgcaggtaacgctctgggctccttccactgccggccacatttcactatcttcaaagtagaaggttacatccaggcatgtagaggactaatgatcgctgcggtcagcctgggatttttcggttccatttttgcactctttggaatgaaatgtaccaaagtcggaggctcagatcaagccaaagctaaaattgcttgcttggccgggattgtattcatattgtcaggtctgtgttccatgacaggctgttccctgtatgcaaacaaaatcacaacagaattctttgatcctctttatatggagcaaaaaatgggctacacatacaacggacccacgtctgccatgtcttctcggaccaagtatcaaggcggagaaggagattttaaaaccacaggcccttcaaaacagtttgataaaaatgcctatgtctaaagagctctggcaagctgcctcctgagttttgttgtgcaagagaactgtcctcacaatagtccttccaaggctctcctgtaattactgcttaagctgttttttaaaaatataaatttgaagactgttaattggatgtaaatgttcttatagttatatactaatcattttctgctgtgcctttctgtaagggaaataaacaggttatttacaaaaaaaaaaaaaaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]