2024-09-28 09:31:14, GGRNA.v2 : RefSeq release 225 (Jul, 2024)
LOCUS NM_001159275 1346 bp mRNA linear ROD 04-AUG-2023 DEFINITION Mus musculus solute carrier family 25 (mitochondrial carrier, ornithine transporter) member 2 (Slc25a2), mRNA; nuclear gene for mitochondrial product. ACCESSION NM_001159275 XM_111757 XM_909128 VERSION NM_001159275.1 KEYWORDS RefSeq; RefSeq Select. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE 1 (bases 1 to 1346) AUTHORS Oyama Y, Miyata H, Shimada K, Fujihara Y, Tokuhiro K, Garcia TX, Matzuk MM and Ikawa M. TITLE CRISPR/Cas9-mediated genome editing reveals 12 testis-enriched genes dispensable for male fertility in mice JOURNAL Asian J Androl 24 (3), 266-272 (2022) PUBMED 34290169 REFERENCE 2 (bases 1 to 1346) AUTHORS Garg,A., O'Rourke,J., Long,C., Doering,J., Ravenscroft,G., Bezprozvannaya,S., Nelson,B.R., Beetz,N., Li,L., Chen,S., Laing,N.G., Grange,R.W., Bassel-Duby,R. and Olson,E.N. TITLE KLHL40 deficiency destabilizes thin filament proteins and promotes nemaline myopathy JOURNAL J Clin Invest 124 (8), 3529-3539 (2014) PUBMED 24960163 REFERENCE 3 (bases 1 to 1346) AUTHORS Wu Q, Zhang T, Cheng JF, Kim Y, Grimwood J, Schmutz J, Dickson M, Noonan JP, Zhang MQ, Myers RM and Maniatis T. TITLE Comparative DNA sequence analysis of mouse and human protocadherin gene clusters JOURNAL Genome Res 11 (3), 389-404 (2001) PUBMED 11230163 REFERENCE 4 (bases 1 to 1346) AUTHORS Wu Q and Maniatis T. TITLE Large exons encoding multiple ectodomains are a characteristic feature of protocadherin genes JOURNAL Proc Natl Acad Sci U S A 97 (7), 3124-3129 (2000) PUBMED 10716726 REFERENCE 5 (bases 1 to 1346) AUTHORS Wu Q and Maniatis T. TITLE A striking organization of a large family of human neural cadherin-like cell adhesion genes JOURNAL Cell 97 (6), 779-790 (1999) PUBMED 10380929 COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from AK077159.1. On or before Apr 11, 2009 this sequence version replaced XM_909128.3, XM_111757.7. ##Evidence-Data-START## Transcript is intronless :: AK077159.1 [ECO:0000345] ##Evidence-Data-END## ##RefSeq-Attributes-START## gene product(s) localized to mito. :: reported by MitoCarta RefSeq Select criteria :: based on single protein-coding transcript ##RefSeq-Attributes-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-1346 AK077159.1 2-1347 FEATURES Location/Qualifiers source 1..1346 /organism="Mus musculus" /mol_type="mRNA" /strain="C57BL/6" /db_xref="taxon:10090" /chromosome="18" /map="18 19.54 cM" gene 1..1346 /gene="Slc25a2" /gene_synonym="Ornt2" /note="solute carrier family 25 (mitochondrial carrier, ornithine transporter) member 2" /db_xref="GeneID:83885" /db_xref="MGI:MGI:2137907" exon 1..1346 /gene="Slc25a2" /gene_synonym="Ornt2" /inference="alignment:Splign:2.1.0" misc_feature 40..42 /gene="Slc25a2" /gene_synonym="Ornt2" /note="upstream in-frame stop codon" CDS 250..1047 /gene="Slc25a2" /gene_synonym="Ornt2" /note="ornithine transporter 2; mitochondrial ornithine transporter" /codon_start=1 /product="mitochondrial ornithine transporter 2" /protein_id="NP_001152747.1" /db_xref="CCDS:CCDS50258.1" /db_xref="GeneID:83885" /db_xref="MGI:MGI:2137907" /translation="
MQTFPQLYKGLADCFLKTYNQVGIRGLYRGTSPALLAYVTQGSVLFMCFGFCQQFVRKVARVEQNAELNDLETATAGSLASAFAALALCPTELVKCRLQTMYEMKMSGKIAQSYNTIWSMVKSIFMKDGPLGFYRGLSTTLAQEIPGYFFYFGGYEISRSFFASGGSKDELGPVPLMLSGGFAGICLWLIIFPVDCIKSRIQVLSMFGKPAGLIETFISVVRNEGISALYSGLKATLIRAIPSNAALFLVYEYSRKMMMNMVEEY"
misc_feature <250..423 /gene="Slc25a2" /gene_synonym="Ornt2" /note="Mitochondrial carrier protein; Region: Mito_carr; pfam00153" /db_xref="CDD:395101" misc_feature <514..735 /gene="Slc25a2" /gene_synonym="Ornt2" /note="Mitochondrial carrier protein; Region: Mito_carr; pfam00153" /db_xref="CDD:395101" misc_feature 754..1032 /gene="Slc25a2" /gene_synonym="Ornt2" /note="Mitochondrial carrier protein; Region: Mito_carr; pfam00153" /db_xref="CDD:395101" ORIGIN
agcggccggagagtgcggcggcggcccaaggctttggtttgagtagccttgacaaggagacagagacacaggtccgcagcagctggccgtgggcgcaaaagagacttggcttctgacgacaccctcgggagggtggaggaacatgaagtccaccctgccatccaagccgccatagacctcactgcgggcgcagcagggggcggagcttgtgtgctgactgggcaacccttcgacaccataaaagtaaagatgcagacatttcctcagctgtacaaaggccttgccgactgcttcctgaaaacatacaaccaagtgggcatccgtggcctttacaggggaaccagtcctgcactgctagcctatgtcacccagggttctgtcctgttcatgtgctttggcttttgccaacagtttgtcaggaaagtggctagagtggagcagaatgcagagctgaacgacttggagactgctactgctgggtcgctggcttctgcatttgctgcgctggctctctgccccactgagcttgtgaagtgtcggctgcagaccatgtatgagatgaagatgtcagggaagatagcacaaagctataacacaatttggtctatggttaagagtatcttcatgaaggatggtcccttaggcttctatcgtggactctcgaccactcttgctcaggaaatacctggctatttcttctactttgggggctatgaaatcagtcgatcattttttgcatcagggggatcaaaggatgaactaggccctgtccctttgatgttaagtggaggctttgctgggatctgtctctggcttatcatattcccagtggactgcattaaatccagaatccaggttctttctatgtttgggaagcctgcaggattaatcgaaacctttataagtgttgtgagaaatgaagggatatcagccttgtattctggattgaaagccactctgattcgagccatcccttccaatgctgctctctttttggtttatgagtacagcagaaagatgatgatgaacatggtggaagaatactgaagtgtctattgatgagtccttgtctgagcacatgaatgagaggaccacagctctacatgtcaaagagttcaagaccaacatggagttagctttgactgggaatttcgggtttgtcttcccttcctcaaatctcataccttgtggagagatctttatatcatatggtttcttcctgcaatcctactgaaataggaaaatcactagttttgctggtggtgggatctacagggtgaacccaagactctatgtacttaatctcaattatcaaggcttcttcataaatctatatatgcatcttg
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]