GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-09-28 09:31:03, GGRNA.v2 : RefSeq release 225 (Jul, 2024)

LOCUS       NM_001114153             800 bp    mRNA    linear   ROD 07-AUG-2023
DEFINITION  Mus musculus reproductive homeobox 2G (Rhox2g), mRNA.
ACCESSION   NM_001114153 XM_486662
VERSION     NM_001114153.1
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Mus musculus (house mouse)
  ORGANISM  Mus musculus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Mus; Mus.
REFERENCE   1  (bases 1 to 800)
  AUTHORS   MacLean,J.A. 2nd, Lorenzetti,D., Hu,Z., Salerno,W.J., Miller,J. and
            Wilkinson,M.F.
  TITLE     Rhox homeobox gene cluster: recent duplication of three family
            members
  JOURNAL   Genesis 44 (3), 122-129 (2006)
   PUBMED   16496311
REFERENCE   2  (bases 1 to 800)
  AUTHORS   Morris L, Gordon J and Blackburn CC.
  TITLE     Identification of a tandem duplicated array in the Rhox alpha locus
            on mouse chromosome X
  JOURNAL   Mamm Genome 17 (2), 178-187 (2006)
   PUBMED   16465597
REFERENCE   3  (bases 1 to 800)
  AUTHORS   Maclean JA 2nd, Chen MA, Wayne CM, Bruce SR, Rao M, Meistrich ML,
            Macleod C and Wilkinson MF.
  TITLE     Rhox: a new homeobox gene cluster
  JOURNAL   Cell 120 (3), 369-382 (2005)
   PUBMED   15707895
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            AL808133.17.
            
            On Feb 1, 2008 this sequence version replaced XM_486662.3.
            
            Sequence Note: The RefSeq transcript and protein were derived from
            genomic sequence to make the sequence consistent with the reference
            genome assembly. The genomic coordinates used for the transcript
            record were based on alignments.
            
            ##Evidence-Data-START##
            Transcript exon combination :: SRR5189685.225673.1,
                                           SRR17253012.5291312.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMN01164134 [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on single protein-coding transcript
            ##RefSeq-Attributes-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-111               AL808133.17        123158-123268       c
            112-523             AL808133.17        122584-122995       c
            524-569             AL808133.17        120955-121000       c
            570-800             AL808133.17        118910-119140       c
FEATURES             Location/Qualifiers
     source          1..800
                     /organism="Mus musculus"
                     /mol_type="mRNA"
                     /strain="C57BL/6"
                     /db_xref="taxon:10090"
                     /chromosome="X"
                     /map="X 21.94 cM"
     gene            1..800
                     /gene="Rhox2g"
                     /gene_synonym="EG434766; Rhox2.7; Rhox2f"
                     /note="reproductive homeobox 2G"
                     /db_xref="GeneID:434766"
                     /db_xref="MGI:MGI:3648776"
     exon            1..111
                     /gene="Rhox2g"
                     /gene_synonym="EG434766; Rhox2.7; Rhox2f"
                     /inference="alignment:Splign:2.1.0"
     CDS             45..620
                     /gene="Rhox2g"
                     /gene_synonym="EG434766; Rhox2.7; Rhox2f"
                     /note="reproductive homeobox 2F"
                     /codon_start=1
                     /product="reproductive homeobox 2G"
                     /protein_id="NP_001107625.1"
                     /db_xref="CCDS:CCDS53059.1"
                     /db_xref="GeneID:434766"
                     /db_xref="MGI:MGI:3648776"
                     /translation="
MERQSINYKLDVGPEEDEENANGIKTLMVLLAGEGRNEGESGRGLPGSGVSAAEGYRAGELSAGGLAAPVADLMDNNNQEDLGATGCAQEKEKQPEEPVPDSMGDLENVKPMSGPWSTVNPVRVLVPEFLHGWQQSFNVLQLQELESIFQCNHYISTTEAKCLARSMGVSKATVQEWFLKRREKYRSYKRL"
     misc_feature    444..602
                     /gene="Rhox2g"
                     /gene_synonym="EG434766; Rhox2.7; Rhox2f"
                     /note="Homeodomain; DNA binding domains involved in the
                     transcriptional regulation of key eukaryotic developmental
                     processes; may bind to DNA as monomers or as homo- and/or
                     heterodimers, in a sequence-specific manner; Region:
                     homeodomain; cd00086"
                     /db_xref="CDD:238039"
     misc_feature    order(450..452,570..572,579..584,591..593)
                     /gene="Rhox2g"
                     /gene_synonym="EG434766; Rhox2.7; Rhox2f"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:238039"
     exon            112..523
                     /gene="Rhox2g"
                     /gene_synonym="EG434766; Rhox2.7; Rhox2f"
                     /inference="alignment:Splign:2.1.0"
     exon            524..569
                     /gene="Rhox2g"
                     /gene_synonym="EG434766; Rhox2.7; Rhox2f"
                     /inference="alignment:Splign:2.1.0"
     exon            570..800
                     /gene="Rhox2g"
                     /gene_synonym="EG434766; Rhox2.7; Rhox2f"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
tgagaggtgtaacagtgaataacgacttccacggctttacagacatggagcgacaaagcatcaattacaagcttgatgtgggacctgaggaggatgaggaaaatgcgaatggtataaagactctgatggtgttgctggctggagagggaagaaacgagggagagagtggacggggcctgcctgggtcgggagtctcagcagcggaaggatacagagcaggagaattaagtgcaggtgggcttgctgcgccagtagccgacctcatggataacaacaaccaagaggaccttggtgccactggctgtgcccaggagaaggagaagcagccagaggagccagtccctgattccatgggggatttggaaaatgtaaagcctatgtcagggccgtggtccactgttaatcctgtgagagtgttggtgcctgaattccttcacggttggcaacagagcttcaatgtgctgcaactacaagagctggagagcatcttccagtgcaatcactacatcagcactacagaggcaaagtgtctggcaagatccatgggtgtgagtaaagccacagtgcaggaatggtttttgaagaggagagagaaatacaggagttataagaggctgtaaaggctcagaggtcctcttcctgcattccggagcatctctctgtgaaggctgtggagaagccccaggcagccacccatgctcaagtcactgtagacagatgatgttgtgccgccaaagtcctgttacaacacagttatctccttaatacttgtatttgcaataaagagctgaattctcaat
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]