 ver.2
Home
|
Help
|
Advanced search
  
Previous release (v1)
ver.2
Home
|
Help
|
Advanced search
  
Previous release (v1)
2025-10-31 18:09:46, GGRNA.v2 : RefSeq release 232 (Sep, 2025)
LOCUS NM_001039696 929 bp mRNA linear ROD 04-AUG-2023 DEFINITION Mus musculus reproductive homeobox 4F (Rhox4f), mRNA. ACCESSION NM_001039696 XM_911486 VERSION NM_001039696.1 KEYWORDS RefSeq; RefSeq Select. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE 1 (bases 1 to 929) AUTHORS MacLean,J.A. 2nd, Lorenzetti,D., Hu,Z., Salerno,W.J., Miller,J. and Wilkinson,M.F. TITLE Rhox homeobox gene cluster: recent duplication of three family members JOURNAL Genesis 44 (3), 122-129 (2006) PUBMED 16496311 REFERENCE 2 (bases 1 to 929) AUTHORS Morris L, Gordon J and Blackburn CC. TITLE Identification of a tandem duplicated array in the Rhox alpha locus on mouse chromosome X JOURNAL Mamm Genome 17 (2), 178-187 (2006) PUBMED 16465597 REFERENCE 3 (bases 1 to 929) AUTHORS Maclean JA 2nd, Chen MA, Wayne CM, Bruce SR, Rao M, Meistrich ML, Macleod C and Wilkinson MF. TITLE Rhox: a new homeobox gene cluster JOURNAL Cell 120 (3), 369-382 (2005) PUBMED 15707895 COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from AJ972670.1. On Mar 8, 2006 this sequence version replaced XM_911486.1. ##Evidence-Data-START## Transcript exon combination :: AJ972670.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMN01164134 [ECO:0000348] ##Evidence-Data-END## ##RefSeq-Attributes-START## RefSeq Select criteria :: based on single protein-coding transcript ##RefSeq-Attributes-END## COMPLETENESS: complete on the 3' end. FEATURES Location/Qualifiers source 1..929 /organism="Mus musculus" /mol_type="mRNA" /strain="C57BL/6" /db_xref="taxon:10090" /chromosome="X" /map="X 21.91 cM" gene 1..929 /gene="Rhox4f" /gene_synonym="Rhox4.6; Rhox4e; Rhox4h" /note="reproductive homeobox 4F" /db_xref="GeneID:636177" /db_xref="MGI:MGI:3613392" exon 1..241 /gene="Rhox4f" /gene_synonym="Rhox4.6; Rhox4e; Rhox4h" /inference="alignment:Splign:2.1.0" CDS 175..792 /gene="Rhox4f" /gene_synonym="Rhox4.6; Rhox4e; Rhox4h" /note="reproductive homeobox 4H" /codon_start=1 /product="reproductive homeobox 4F" /protein_id="NP_001034785.1" /db_xref="CCDS:CCDS40938.1" /db_xref="GeneID:636177" /db_xref="MGI:MGI:3613392" /translation="
MEHQNTNYLLHEGLVKDKEKLNGRKTQTVLPLDGEGRNEGESGLGQSGATAVEGDKAEELSGEGGPAAGDADLMDNSNQEDQDTSGSAQEEEKLPEEPVLKDAVVIDKVQPIPVLVSGVRPKSVWVQQRSLHYNFQWWQLQELERIFQQNHFIRAEERRHLARWIGVSEARVMTWFKKRREHFRRGQSQLGMNDDAPVGSHSTFL"
     misc_feature    559..735
                     /gene="Rhox4f"
                     /gene_synonym="Rhox4.6; Rhox4e; Rhox4h"
                     /note="Homeodomain; DNA binding domains involved in the
                     transcriptional regulation of key eukaryotic developmental
                     processes; may bind to DNA as monomers or as homo- and/or
                     heterodimers, in a sequence-specific manner; Region:
                     homeodomain; cd00086"
                     /db_xref="CDD:238039"
     misc_feature    order(559..573,577..579,628..630,646..648,685..687,
                     691..696,703..708,712..720,724..729)
                     /gene="Rhox4f"
                     /gene_synonym="Rhox4.6; Rhox4e; Rhox4h"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238039"
     misc_feature    order(565..567,574..576,694..696,703..708,715..717)
                     /gene="Rhox4f"
                     /gene_synonym="Rhox4.6; Rhox4e; Rhox4h"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:238039"
     exon            242..647
                     /gene="Rhox4f"
                     /gene_synonym="Rhox4.6; Rhox4e; Rhox4h"
                     /inference="alignment:Splign:2.1.0"
     exon            648..693
                     /gene="Rhox4f"
                     /gene_synonym="Rhox4.6; Rhox4e; Rhox4h"
                     /inference="alignment:Splign:2.1.0"
     exon            694..929
                     /gene="Rhox4f"
                     /gene_synonym="Rhox4.6; Rhox4e; Rhox4h"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
aggttttcggctttcagctttcggctttcggctttcggctttcggctttcggctttcggctttcggctttcggctttcggctttaggcttttggctttcgcctttaggttttctaaacctcaggatgtccgactcagattctgctggggaaagctgcagggaagcactcaggacatggagcatcaaaacaccaactacctacttcatgagggacttgtcaaggacaaggaaaagttgaatggtaggaagacacagacagtcttaccactggatggagagggaagaaatgagggagagagtggactgggccagtccggagccacagcagtggaaggggacaaagcagaagaattaagtggagaaggtgggcctgctgctggtgatgcagacctcatggataacagcaaccaagaggaccaggacaccagtggcagtgcccaggaggaggagaagctgccagaggagccagttctcaaggatgctgtggtcatagacaaagtgcagcctattccagtgctggtatctggtgtgcggcctaagtcagtgtgggtacagcagcgtagcttacactacaatttccaatggtggcagctgcaggagctggagcgcattttccagcagaatcacttcatccgtgcagaggaaagaagacatctggcaagatggataggtgtgagtgaagccagagttatgacatggtttaagaagaggagagagcacttcagaagaggacaaagtcagttaggaatgaatgatgatgcccctgtggggtcccactctacctttctctgaagatggcacaggaggcctggtgtaccacccttgaccaggagccacgtgcagacccctgctgccttccaccagcatgttattgcatctctatcccctaagcatttgtatgtgaaataaatagattctcagtttctttg
//
by
@meso_cacase at 
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]