GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-09-19 15:11:07, GGRNA.v2 : RefSeq release 231 (Jul, 2025)

LOCUS       NM_001025084             883 bp    mRNA    linear   ROD 04-AUG-2023
DEFINITION  Mus musculus reproductive homeobox 1 (Rhox1), mRNA.
ACCESSION   NM_001025084 XM_358201
VERSION     NM_001025084.2
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Mus musculus (house mouse)
  ORGANISM  Mus musculus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Mus; Mus.
REFERENCE   1  (bases 1 to 883)
  AUTHORS   Song HW, Bettegowda A, Lake BB, Zhao AH, Skarbrevik D, Babajanian
            E, Sukhwani M, Shum EY, Phan MH, Plank TM, Richardson ME, Ramaiah
            M, Sridhar V, de Rooij DG, Orwig KE, Zhang K and Wilkinson MF.
  TITLE     The Homeobox Transcription Factor RHOX10 Drives Mouse
            Spermatogonial Stem Cell Establishment
  JOURNAL   Cell Rep 17 (1), 149-164 (2016)
   PUBMED   27681428
REFERENCE   2  (bases 1 to 883)
  AUTHORS   Song HW, Bettegowda A, Oliver D, Yan W, Phan MH, de Rooij DG,
            Corbett MA and Wilkinson MF.
  TITLE     shRNA off-target effects in vivo: impaired endogenous siRNA
            expression and spermatogenic defects
  JOURNAL   PLoS One 10 (3), e0118549 (2015)
   PUBMED   25790000
  REMARK    Publication Status: Online-Only
REFERENCE   3  (bases 1 to 883)
  AUTHORS   Thompson CL, Ng L, Menon V, Martinez S, Lee CK, Glattfelder K,
            Sunkin SM, Henry A, Lau C, Dang C, Garcia-Lopez R, Martinez-Ferre
            A, Pombero A, Rubenstein JLR, Wakeman WB, Hohmann J, Dee N, Sodt
            AJ, Young R, Smith K, Nguyen TN, Kidney J, Kuan L, Jeromin A,
            Kaykas A, Miller J, Page D, Orta G, Bernard A, Riley Z, Smith S,
            Wohnoutka P, Hawrylycz MJ, Puelles L and Jones AR.
  TITLE     A high-resolution spatiotemporal atlas of gene expression of the
            developing mouse brain
  JOURNAL   Neuron 83 (2), 309-323 (2014)
   PUBMED   24952961
REFERENCE   4  (bases 1 to 883)
  AUTHORS   Daggag H, Svingen T, Western PS, van den Bergen JA, McClive PJ,
            Harley VR, Koopman P and Sinclair AH.
  TITLE     The rhox homeobox gene family shows sexually dimorphic and dynamic
            expression during mouse embryonic gonad development
  JOURNAL   Biol Reprod 79 (3), 468-474 (2008)
   PUBMED   18562707
REFERENCE   5  (bases 1 to 883)
  AUTHORS   Oda M, Yamagiwa A, Yamamoto S, Nakayama T, Tsumura A, Sasaki H,
            Nakao K, Li E and Okano M.
  TITLE     DNA methylation regulates long-range gene silencing of an X-linked
            homeobox gene cluster in a lineage-specific manner
  JOURNAL   Genes Dev 20 (24), 3382-3394 (2006)
   PUBMED   17182866
REFERENCE   6  (bases 1 to 883)
  AUTHORS   Jackson M, Watt AJ, Gautier P, Gilchrist D, Driehaus J, Graham GJ,
            Keebler J, Prugnolle F, Awadalla P and Forrester LM.
  TITLE     A murine specific expansion of the Rhox cluster involved in
            embryonic stem cell biology is under natural selection
  JOURNAL   BMC Genomics 7, 212 (2006)
   PUBMED   16916441
  REMARK    Publication Status: Online-Only
REFERENCE   7  (bases 1 to 883)
  AUTHORS   MacLean,J.A. 2nd, Lorenzetti,D., Hu,Z., Salerno,W.J., Miller,J. and
            Wilkinson,M.F.
  TITLE     Rhox homeobox gene cluster: recent duplication of three family
            members
  JOURNAL   Genesis 44 (3), 122-129 (2006)
   PUBMED   16496311
REFERENCE   8  (bases 1 to 883)
  AUTHORS   Morris L, Gordon J and Blackburn CC.
  TITLE     Identification of a tandem duplicated array in the Rhox alpha locus
            on mouse chromosome X
  JOURNAL   Mamm Genome 17 (2), 178-187 (2006)
   PUBMED   16465597
REFERENCE   9  (bases 1 to 883)
  AUTHORS   Maclean JA 2nd, Chen MA, Wayne CM, Bruce SR, Rao M, Meistrich ML,
            Macleod C and Wilkinson MF.
  TITLE     Rhox: a new homeobox gene cluster
  JOURNAL   Cell 120 (3), 369-382 (2005)
   PUBMED   15707895
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            DQ058638.1.
            
            On Sep 23, 2006 this sequence version replaced NM_001025084.1.
            
            ##Evidence-Data-START##
            Transcript exon combination :: DQ058638.1 [ECO:0000332]
            RNAseq introns              :: partial sample support SAMN01164134
                                           [ECO:0000350]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on longest protein
            ##RefSeq-Attributes-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-700               DQ058638.1         1-700
            701-883             DQ058638.1         702-884
FEATURES             Location/Qualifiers
     source          1..883
                     /organism="Mus musculus"
                     /mol_type="mRNA"
                     /strain="C57BL/6"
                     /db_xref="taxon:10090"
                     /chromosome="X"
                     /map="X 21.63 cM"
     gene            1..883
                     /gene="Rhox1"
                     /note="reproductive homeobox 1"
                     /db_xref="GeneID:385343"
                     /db_xref="MGI:MGI:3580237"
     exon            1..139
                     /gene="Rhox1"
                     /inference="alignment:Splign:2.1.0"
     CDS             16..690
                     /gene="Rhox1"
                     /note="reproductive homeobox on X chromosome 1;
                     reproductive homeobox on chromosome X, 1"
                     /codon_start=1
                     /product="reproductive homeobox 1"
                     /protein_id="NP_001020255.2"
                     /db_xref="CCDS:CCDS40929.1"
                     /db_xref="GeneID:385343"
                     /db_xref="MGI:MGI:3580237"
                     /translation="
MVVTRGKGHRSHRAALAFGCHTNKIRETFLWLKNLGKLTYTDSTDTQAASCSDGFRNMEHQSIYHLLRIIPEDEENANGVMALLAGEGRNEGESGPGQPGSGVAAAASAFSRQDGPAAGAAGFMVPCTREGHDWENAQQLQQPVFWSMRDARVAQPGPPPKGKCGLSNRFSRWQLQQLELLFQRTQYISAQDRKRLAVCLCVCEAKVQNWFQRRRAEYRKYHNS"
     misc_feature    <565..675
                     /gene="Rhox1"
                     /note="Region: Homeodomain; pfam00046"
                     /db_xref="CDD:459649"
     exon            140..250
                     /gene="Rhox1"
                     /inference="alignment:Splign:2.1.0"
     exon            251..593
                     /gene="Rhox1"
                     /inference="alignment:Splign:2.1.0"
     exon            594..639
                     /gene="Rhox1"
                     /inference="alignment:Splign:2.1.0"
     exon            640..883
                     /gene="Rhox1"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
gacccctccaaccccatggtggtcacaaggggcaaaggtcataggtcacacagggcagcattggcctttggctgtcacaccaacaagattcgagagacattcctgtggctaaagaacttaggaaaactgacctacactgactctacagacacacaagctgcaagctgctccgacggctttcggaacatggagcaccaaagcatctatcacctgcttcgtataatacctgaggatgaggaaaatgcgaatggtgtgatggccttgctggctggagaaggaagaaacgagggagagagtggaccgggccagcctgggtctggagtagcagcagccgcctcagcattcagtagacaagatgggcctgctgctggtgctgcaggcttcatggttccctgtacccgagaaggccatgactgggagaatgcacagcagcttcagcagccggttttctggagtatgagagacgcccgggttgcgcagcctgggccaccgccgaagggcaaatgtggcctcagcaacaggttctcccgctggcagctgcagcagctggagcttcttttccagcgcactcagtacatcagtgcacaagacagaaaacggctggcagtgtgtctgtgtgtgtgtgaagccaaagtgcagaattggtttcaaaggagaagagcagaatataggaaatatcataattcataaacaaaggctcagaggtgttcctcctcctgataagcacatcacctttccctgaagattgtggagaggcctcaaggttagcccttgcctgggagccagatgcagaggctatccccccctcctgcacccccccacctccccccccaccaacctattgtttcagccatatcccctcagcacttgtgctttcaataaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]