2025-09-19 15:11:07, GGRNA.v2 : RefSeq release 231 (Jul, 2025)
LOCUS NM_001025084 883 bp mRNA linear ROD 04-AUG-2023 DEFINITION Mus musculus reproductive homeobox 1 (Rhox1), mRNA. ACCESSION NM_001025084 XM_358201 VERSION NM_001025084.2 KEYWORDS RefSeq; RefSeq Select. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE 1 (bases 1 to 883) AUTHORS Song HW, Bettegowda A, Lake BB, Zhao AH, Skarbrevik D, Babajanian E, Sukhwani M, Shum EY, Phan MH, Plank TM, Richardson ME, Ramaiah M, Sridhar V, de Rooij DG, Orwig KE, Zhang K and Wilkinson MF. TITLE The Homeobox Transcription Factor RHOX10 Drives Mouse Spermatogonial Stem Cell Establishment JOURNAL Cell Rep 17 (1), 149-164 (2016) PUBMED 27681428 REFERENCE 2 (bases 1 to 883) AUTHORS Song HW, Bettegowda A, Oliver D, Yan W, Phan MH, de Rooij DG, Corbett MA and Wilkinson MF. TITLE shRNA off-target effects in vivo: impaired endogenous siRNA expression and spermatogenic defects JOURNAL PLoS One 10 (3), e0118549 (2015) PUBMED 25790000 REMARK Publication Status: Online-Only REFERENCE 3 (bases 1 to 883) AUTHORS Thompson CL, Ng L, Menon V, Martinez S, Lee CK, Glattfelder K, Sunkin SM, Henry A, Lau C, Dang C, Garcia-Lopez R, Martinez-Ferre A, Pombero A, Rubenstein JLR, Wakeman WB, Hohmann J, Dee N, Sodt AJ, Young R, Smith K, Nguyen TN, Kidney J, Kuan L, Jeromin A, Kaykas A, Miller J, Page D, Orta G, Bernard A, Riley Z, Smith S, Wohnoutka P, Hawrylycz MJ, Puelles L and Jones AR. TITLE A high-resolution spatiotemporal atlas of gene expression of the developing mouse brain JOURNAL Neuron 83 (2), 309-323 (2014) PUBMED 24952961 REFERENCE 4 (bases 1 to 883) AUTHORS Daggag H, Svingen T, Western PS, van den Bergen JA, McClive PJ, Harley VR, Koopman P and Sinclair AH. TITLE The rhox homeobox gene family shows sexually dimorphic and dynamic expression during mouse embryonic gonad development JOURNAL Biol Reprod 79 (3), 468-474 (2008) PUBMED 18562707 REFERENCE 5 (bases 1 to 883) AUTHORS Oda M, Yamagiwa A, Yamamoto S, Nakayama T, Tsumura A, Sasaki H, Nakao K, Li E and Okano M. TITLE DNA methylation regulates long-range gene silencing of an X-linked homeobox gene cluster in a lineage-specific manner JOURNAL Genes Dev 20 (24), 3382-3394 (2006) PUBMED 17182866 REFERENCE 6 (bases 1 to 883) AUTHORS Jackson M, Watt AJ, Gautier P, Gilchrist D, Driehaus J, Graham GJ, Keebler J, Prugnolle F, Awadalla P and Forrester LM. TITLE A murine specific expansion of the Rhox cluster involved in embryonic stem cell biology is under natural selection JOURNAL BMC Genomics 7, 212 (2006) PUBMED 16916441 REMARK Publication Status: Online-Only REFERENCE 7 (bases 1 to 883) AUTHORS MacLean,J.A. 2nd, Lorenzetti,D., Hu,Z., Salerno,W.J., Miller,J. and Wilkinson,M.F. TITLE Rhox homeobox gene cluster: recent duplication of three family members JOURNAL Genesis 44 (3), 122-129 (2006) PUBMED 16496311 REFERENCE 8 (bases 1 to 883) AUTHORS Morris L, Gordon J and Blackburn CC. TITLE Identification of a tandem duplicated array in the Rhox alpha locus on mouse chromosome X JOURNAL Mamm Genome 17 (2), 178-187 (2006) PUBMED 16465597 REFERENCE 9 (bases 1 to 883) AUTHORS Maclean JA 2nd, Chen MA, Wayne CM, Bruce SR, Rao M, Meistrich ML, Macleod C and Wilkinson MF. TITLE Rhox: a new homeobox gene cluster JOURNAL Cell 120 (3), 369-382 (2005) PUBMED 15707895 COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from DQ058638.1. On Sep 23, 2006 this sequence version replaced NM_001025084.1. ##Evidence-Data-START## Transcript exon combination :: DQ058638.1 [ECO:0000332] RNAseq introns :: partial sample support SAMN01164134 [ECO:0000350] ##Evidence-Data-END## ##RefSeq-Attributes-START## RefSeq Select criteria :: based on longest protein ##RefSeq-Attributes-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-700 DQ058638.1 1-700 701-883 DQ058638.1 702-884 FEATURES Location/Qualifiers source 1..883 /organism="Mus musculus" /mol_type="mRNA" /strain="C57BL/6" /db_xref="taxon:10090" /chromosome="X" /map="X 21.63 cM" gene 1..883 /gene="Rhox1" /note="reproductive homeobox 1" /db_xref="GeneID:385343" /db_xref="MGI:MGI:3580237" exon 1..139 /gene="Rhox1" /inference="alignment:Splign:2.1.0" CDS 16..690 /gene="Rhox1" /note="reproductive homeobox on X chromosome 1; reproductive homeobox on chromosome X, 1" /codon_start=1 /product="reproductive homeobox 1" /protein_id="NP_001020255.2" /db_xref="CCDS:CCDS40929.1" /db_xref="GeneID:385343" /db_xref="MGI:MGI:3580237" /translation="
MVVTRGKGHRSHRAALAFGCHTNKIRETFLWLKNLGKLTYTDSTDTQAASCSDGFRNMEHQSIYHLLRIIPEDEENANGVMALLAGEGRNEGESGPGQPGSGVAAAASAFSRQDGPAAGAAGFMVPCTREGHDWENAQQLQQPVFWSMRDARVAQPGPPPKGKCGLSNRFSRWQLQQLELLFQRTQYISAQDRKRLAVCLCVCEAKVQNWFQRRRAEYRKYHNS"
misc_feature <565..675 /gene="Rhox1" /note="Region: Homeodomain; pfam00046" /db_xref="CDD:459649" exon 140..250 /gene="Rhox1" /inference="alignment:Splign:2.1.0" exon 251..593 /gene="Rhox1" /inference="alignment:Splign:2.1.0" exon 594..639 /gene="Rhox1" /inference="alignment:Splign:2.1.0" exon 640..883 /gene="Rhox1" /inference="alignment:Splign:2.1.0" ORIGIN
gacccctccaaccccatggtggtcacaaggggcaaaggtcataggtcacacagggcagcattggcctttggctgtcacaccaacaagattcgagagacattcctgtggctaaagaacttaggaaaactgacctacactgactctacagacacacaagctgcaagctgctccgacggctttcggaacatggagcaccaaagcatctatcacctgcttcgtataatacctgaggatgaggaaaatgcgaatggtgtgatggccttgctggctggagaaggaagaaacgagggagagagtggaccgggccagcctgggtctggagtagcagcagccgcctcagcattcagtagacaagatgggcctgctgctggtgctgcaggcttcatggttccctgtacccgagaaggccatgactgggagaatgcacagcagcttcagcagccggttttctggagtatgagagacgcccgggttgcgcagcctgggccaccgccgaagggcaaatgtggcctcagcaacaggttctcccgctggcagctgcagcagctggagcttcttttccagcgcactcagtacatcagtgcacaagacagaaaacggctggcagtgtgtctgtgtgtgtgtgaagccaaagtgcagaattggtttcaaaggagaagagcagaatataggaaatatcataattcataaacaaaggctcagaggtgttcctcctcctgataagcacatcacctttccctgaagattgtggagaggcctcaaggttagcccttgcctgggagccagatgcagaggctatccccccctcctgcacccccccacctccccccccaccaacctattgtttcagccatatcccctcagcacttgtgctttcaataaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]