2024-09-28 09:30:58, GGRNA.v2 : RefSeq release 225 (Jul, 2024)
LOCUS NM_001025083 935 bp mRNA linear ROD 04-AUG-2023 DEFINITION Mus musculus reproductive homeobox 12 (Rhox12), mRNA. ACCESSION NM_001025083 XM_356400 VERSION NM_001025083.2 KEYWORDS RefSeq; RefSeq Select. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE 1 (bases 1 to 935) AUTHORS Thompson CL, Ng L, Menon V, Martinez S, Lee CK, Glattfelder K, Sunkin SM, Henry A, Lau C, Dang C, Garcia-Lopez R, Martinez-Ferre A, Pombero A, Rubenstein JLR, Wakeman WB, Hohmann J, Dee N, Sodt AJ, Young R, Smith K, Nguyen TN, Kidney J, Kuan L, Jeromin A, Kaykas A, Miller J, Page D, Orta G, Bernard A, Riley Z, Smith S, Wohnoutka P, Hawrylycz MJ, Puelles L and Jones AR. TITLE A high-resolution spatiotemporal atlas of gene expression of the developing mouse brain JOURNAL Neuron 83 (2), 309-323 (2014) PUBMED 24952961 REFERENCE 2 (bases 1 to 935) AUTHORS Daggag H, Svingen T, Western PS, van den Bergen JA, McClive PJ, Harley VR, Koopman P and Sinclair AH. TITLE The rhox homeobox gene family shows sexually dimorphic and dynamic expression during mouse embryonic gonad development JOURNAL Biol Reprod 79 (3), 468-474 (2008) PUBMED 18562707 REFERENCE 3 (bases 1 to 935) AUTHORS Oda M, Yamagiwa A, Yamamoto S, Nakayama T, Tsumura A, Sasaki H, Nakao K, Li E and Okano M. TITLE DNA methylation regulates long-range gene silencing of an X-linked homeobox gene cluster in a lineage-specific manner JOURNAL Genes Dev 20 (24), 3382-3394 (2006) PUBMED 17182866 REFERENCE 4 (bases 1 to 935) AUTHORS Maclean JA 2nd, Chen MA, Wayne CM, Bruce SR, Rao M, Meistrich ML, Macleod C and Wilkinson MF. TITLE Rhox: a new homeobox gene cluster JOURNAL Cell 120 (3), 369-382 (2005) PUBMED 15707895 COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from DQ058649.1 and BU757254.1. On Apr 7, 2006 this sequence version replaced NM_001025083.1. ##Evidence-Data-START## Transcript exon combination :: DQ058649.1, BC132548.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMN01164134 [ECO:0000348] ##Evidence-Data-END## ##RefSeq-Attributes-START## RefSeq Select criteria :: based on single protein-coding transcript ##RefSeq-Attributes-END## COMPLETENESS: complete on the 3' end. PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-920 DQ058649.1 1-920 921-935 BU757254.1 17-31 c FEATURES Location/Qualifiers source 1..935 /organism="Mus musculus" /mol_type="mRNA" /strain="C57BL/6" /db_xref="taxon:10090" /chromosome="X" /map="X 22.36 cM" gene 1..935 /gene="Rhox12" /gene_synonym="Gm1148" /note="reproductive homeobox 12" /db_xref="GeneID:382282" /db_xref="MGI:MGI:2685994" exon 1..250 /gene="Rhox12" /gene_synonym="Gm1148" /inference="alignment:Splign:2.1.0" misc_feature 226..228 /gene="Rhox12" /gene_synonym="Gm1148" /note="upstream in-frame stop codon" exon 251..677 /gene="Rhox12" /gene_synonym="Gm1148" /inference="alignment:Splign:2.1.0" CDS 259..819 /gene="Rhox12" /gene_synonym="Gm1148" /codon_start=1 /product="reproductive homeobox on X chromosome, 12" /protein_id="NP_001020254.1" /db_xref="CCDS:CCDS30087.1" /db_xref="GeneID:382282" /db_xref="MGI:MGI:2685994" /translation="
MALEPHHVDPNFYKLGENEIEVTLDADQEADGAAEGGSFGDGSLNGSDKLKCQGIPDDKDDVIYVGELKNIGNDIKDECHGSHQGSGDPQPEEKQKNSAAARVPQVRRTRPRIQLGFTPRQLNELEDFFEKTKYPDALTRKNLAKHLYLAESKVQRWFKKRRAHYRKEQQSQVLQCASADGQDAMQ"
misc_feature 577..765 /gene="Rhox12" /gene_synonym="Gm1148" /note="Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner; Region: homeodomain; cd00086" /db_xref="CDD:238039" misc_feature order(577..591,607..609,658..660,676..678,715..717, 721..726,733..738,742..750,754..759) /gene="Rhox12" /gene_synonym="Gm1148" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature order(583..585,592..594,724..726,733..738,745..747) /gene="Rhox12" /gene_synonym="Gm1148" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" exon 678..723 /gene="Rhox12" /gene_synonym="Gm1148" /inference="alignment:Splign:2.1.0" exon 724..935 /gene="Rhox12" /gene_synonym="Gm1148" /inference="alignment:Splign:2.1.0" ORIGIN
tggagcagcctggaagagaccagcagaactgcttggacggagcaaagagcagttgagctgcctggaagaggttcagactaactgagccacctggaaagagtctgtaacctgttgagctgcctgcaggccgtagagcgtgctttgggtttccagattttatgagccaccactcatgctgagataggctttggtgacaaagctgtctttgagtcatctctgctcctgtaagcaacccctcgcccatattcctattccaccatggctctcgaaccccatcatgtggaccccaatttctacaaactgggggagaatgagatcgaagtgacccttgatgctgatcaagaggctgatggagcagcagagggaggcagctttggagacggttctctaaatggctcagacaaattaaagtgccagggcatcccagacgacaaggatgatgtgatctacgttggagaattgaagaacattggcaatgacatcaaagacgagtgccatgggagccatcaagggtctggagatccacagccggaggagaagcagaagaactcggcggctgccagagttccacaggtccggcgcacaaggccacggatccagttgggtttcacgcccaggcaactgaatgaactggaagacttttttgaaaaaactaagtaccctgatgcactcacaaggaagaaccttgcaaagcacttgtacctagcagaatccaaagttcagagatggtttaagaaaagaagagcccattataggaaagaacagcagtctcaagtgctgcagtgtgcatctgctgatggccaggatgccatgcagtgacgcttttggaggagttctgaggcatcatcttctccagccgtcagatgaaagcatgttaagcactaatactaaccatggatccttatcccttaagcaataaaaagatgtgcattcaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]