LOCUS       NM_001025083             935 bp    mRNA    linear   ROD 04-AUG-2023
DEFINITION  Mus musculus reproductive homeobox 12 (Rhox12), mRNA.
ACCESSION   NM_001025083 XM_356400
VERSION     NM_001025083.2
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Mus musculus (house mouse)
  ORGANISM  Mus musculus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Mus; Mus.
REFERENCE   1  (bases 1 to 935)
  AUTHORS   Thompson CL, Ng L, Menon V, Martinez S, Lee CK, Glattfelder K,
            Sunkin SM, Henry A, Lau C, Dang C, Garcia-Lopez R, Martinez-Ferre
            A, Pombero A, Rubenstein JLR, Wakeman WB, Hohmann J, Dee N, Sodt
            AJ, Young R, Smith K, Nguyen TN, Kidney J, Kuan L, Jeromin A,
            Kaykas A, Miller J, Page D, Orta G, Bernard A, Riley Z, Smith S,
            Wohnoutka P, Hawrylycz MJ, Puelles L and Jones AR.
  TITLE     A high-resolution spatiotemporal atlas of gene expression of the
            developing mouse brain
  JOURNAL   Neuron 83 (2), 309-323 (2014)
   PUBMED   24952961
REFERENCE   2  (bases 1 to 935)
  AUTHORS   Daggag H, Svingen T, Western PS, van den Bergen JA, McClive PJ,
            Harley VR, Koopman P and Sinclair AH.
  TITLE     The rhox homeobox gene family shows sexually dimorphic and dynamic
            expression during mouse embryonic gonad development
  JOURNAL   Biol Reprod 79 (3), 468-474 (2008)
   PUBMED   18562707
REFERENCE   3  (bases 1 to 935)
  AUTHORS   Oda M, Yamagiwa A, Yamamoto S, Nakayama T, Tsumura A, Sasaki H,
            Nakao K, Li E and Okano M.
  TITLE     DNA methylation regulates long-range gene silencing of an X-linked
            homeobox gene cluster in a lineage-specific manner
  JOURNAL   Genes Dev 20 (24), 3382-3394 (2006)
   PUBMED   17182866
REFERENCE   4  (bases 1 to 935)
  AUTHORS   Maclean JA 2nd, Chen MA, Wayne CM, Bruce SR, Rao M, Meistrich ML,
            Macleod C and Wilkinson MF.
  TITLE     Rhox: a new homeobox gene cluster
  JOURNAL   Cell 120 (3), 369-382 (2005)
   PUBMED   15707895
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            DQ058649.1 and BU757254.1.
            
            On Apr 7, 2006 this sequence version replaced NM_001025083.1.
            
            ##Evidence-Data-START##
            Transcript exon combination :: DQ058649.1, BC132548.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMN01164134 [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on single protein-coding transcript
            ##RefSeq-Attributes-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-920               DQ058649.1         1-920
            921-935             BU757254.1         17-31               c
FEATURES             Location/Qualifiers
     source          1..935
                     /organism="Mus musculus"
                     /mol_type="mRNA"
                     /strain="C57BL/6"
                     /db_xref="taxon:10090"
                     /chromosome="X"
                     /map="X 22.36 cM"
     gene            1..935
                     /gene="Rhox12"
                     /gene_synonym="Gm1148"
                     /note="reproductive homeobox 12"
                     /db_xref="GeneID:382282"
                     /db_xref="MGI:MGI:2685994"
     exon            1..250
                     /gene="Rhox12"
                     /gene_synonym="Gm1148"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    226..228
                     /gene="Rhox12"
                     /gene_synonym="Gm1148"
                     /note="upstream in-frame stop codon"
     exon            251..677
                     /gene="Rhox12"
                     /gene_synonym="Gm1148"
                     /inference="alignment:Splign:2.1.0"
     CDS             259..819
                     /gene="Rhox12"
                     /gene_synonym="Gm1148"
                     /codon_start=1
                     /product="reproductive homeobox on X chromosome, 12"
                     /protein_id="NP_001020254.1"
                     /db_xref="CCDS:CCDS30087.1"
                     /db_xref="GeneID:382282"
                     /db_xref="MGI:MGI:2685994"
                     /translation="

MALEPHHVDPNFYKLGENEIEVTLDADQEADGAAEGGSFGDGSLNGSDKLKCQGIPDDKDDVIYVGELKNIGNDIKDECHGSHQGSGDPQPEEKQKNSAAARVPQVRRTRPRIQLGFTPRQLNELEDFFEKTKYPDALTRKNLAKHLYLAESKVQRWFKKRRAHYRKEQQSQVLQCASADGQDAMQ"

     misc_feature    577..765
                     /gene="Rhox12"
                     /gene_synonym="Gm1148"
                     /note="Homeodomain; DNA binding domains involved in the
                     transcriptional regulation of key eukaryotic developmental
                     processes; may bind to DNA as monomers or as homo- and/or
                     heterodimers, in a sequence-specific manner; Region:
                     homeodomain; cd00086"
                     /db_xref="CDD:238039"
     misc_feature    order(577..591,607..609,658..660,676..678,715..717,
                     721..726,733..738,742..750,754..759)
                     /gene="Rhox12"
                     /gene_synonym="Gm1148"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238039"
     misc_feature    order(583..585,592..594,724..726,733..738,745..747)
                     /gene="Rhox12"
                     /gene_synonym="Gm1148"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:238039"
     exon            678..723
                     /gene="Rhox12"
                     /gene_synonym="Gm1148"
                     /inference="alignment:Splign:2.1.0"
     exon            724..935
                     /gene="Rhox12"
                     /gene_synonym="Gm1148"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      

tggagcagcctggaagagaccagcagaactgcttggacggagcaaagagcagttgagctgcctggaagaggttcagactaactgagccacctggaaagagtctgtaacctgttgagctgcctgcaggccgtagagcgtgctttgggtttccagattttatgagccaccactcatgctgagataggctttggtgacaaagctgtctttgagtcatctctgctcctgtaagcaacccctcgcccatattcctattccaccatggctctcgaaccccatcatgtggaccccaatttctacaaactgggggagaatgagatcgaagtgacccttgatgctgatcaagaggctgatggagcagcagagggaggcagctttggagacggttctctaaatggctcagacaaattaaagtgccagggcatcccagacgacaaggatgatgtgatctacgttggagaattgaagaacattggcaatgacatcaaagacgagtgccatgggagccatcaagggtctggagatccacagccggaggagaagcagaagaactcggcggctgccagagttccacaggtccggcgcacaaggccacggatccagttgggtttcacgcccaggcaactgaatgaactggaagacttttttgaaaaaactaagtaccctgatgcactcacaaggaagaaccttgcaaagcacttgtacctagcagaatccaaagttcagagatggtttaagaaaagaagagcccattataggaaagaacagcagtctcaagtgctgcagtgtgcatctgctgatggccaggatgccatgcagtgacgcttttggaggagttctgaggcatcatcttctccagccgtcagatgaaagcatgttaagcactaatactaaccatggatccttatcccttaagcaataaaaagatgtgcattcaa

//