LOCUS       NM_001001796            1550 bp    mRNA    linear   ROD 04-MAR-2025
DEFINITION  Mus musculus dorsal root ganglia homeobox (Drgx), transcript
            variant 2, mRNA.
ACCESSION   NM_001001796 XM_138962
VERSION     NM_001001796.4
KEYWORDS    RefSeq.
SOURCE      Mus musculus (house mouse)
  ORGANISM  Mus musculus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Mus; Mus.
REFERENCE   1  (bases 1 to 1550)
  AUTHORS   Baltar,J., Miranda,R.M., Cabral,M., Rebelo,S., Grahammer,F.,
            Huber,T.B., Reguenga,C. and Monteiro,F.A.
  TITLE     Neph1 is required for neurite branching and is negatively regulated
            by the PRRXL1 homeodomain factor in the developing spinal cord
            dorsal horn
  JOURNAL   Neural Dev 19 (1), 13 (2024)
   PUBMED   39049046
  REMARK    Publication Status: Online-Only
REFERENCE   2  (bases 1 to 1550)
  AUTHORS   Adams,D.J., Barlas,B., McIntyre,R.E., Salguero,I., van der
            Weyden,L., Barros,A., Vicente,J.R., Karimpour,N., Haider,A.,
            Ranzani,M., Turner,G., Thompson,N.A., Harle,V., Olvera-Leon,R.,
            Robles-Espinoza,C.D., Speak,A.O., Geisler,N., Weninger,W.J.,
            Geyer,S.H., Hewinson,J., Karp,N.A., Fu,B., Yang,F., Kozik,Z.,
            Choudhary,J., Yu,L., van Ruiten,M.S., Rowland,B.D., Lelliott,C.J.,
            Del Castillo Velasco-Herrera,M., Verstraten,R., Bruckner,L.,
            Henssen,A.G., Rooimans,M.A., de Lange,J., Mohun,T.J., Arends,M.J.,
            Kentistou,K.A., Coelho,P.A., Zhao,Y., Zecchini,H., Perry,J.R.B.,
            Jackson,S.P. and Balmus,G.
  CONSRTM   Sanger Mouse Genetics Project
  TITLE     Genetic determinants of micronucleus formation in vivo
  JOURNAL   Nature 627 (8002), 130-136 (2024)
   PUBMED   38355793
REFERENCE   3  (bases 1 to 1550)
  AUTHORS   Lowenstein,E.D., Ruffault,P.L., Misios,A., Osman,K.L., Li,H.,
            Greenberg,R.S., Thompson,R., Song,K., Dietrich,S., Li,X.,
            Vladimirov,N., Woehler,A., Brunet,J.F., Zampieri,N., Kuhn,R.,
            Liberles,S.D., Jia,S., Lewin,G.R., Rajewsky,N., Lever,T.E. and
            Birchmeier,C.
  TITLE     Prox2 and Runx3 vagal sensory neurons regulate esophageal motility
  JOURNAL   Neuron 111 (14), 2184-2200 (2023)
   PUBMED   37192624
REFERENCE   4  (bases 1 to 1550)
  AUTHORS   Hernandez-Miranda,L.R., Ibrahim,D.M., Ruffault,P.L., Larrosa,M.,
            Balueva,K., Muller,T., Weerd,W., Stolte-Dijkstra,I., Hostra,R.M.W.,
            Brunet,J.F., Fortin,G., Mundlos,S. and Birchmeier,C.
  TITLE     Mutation in LBX1/Lbx1 precludes transcription factor cooperativity
            and causes congenital hypoventilation in humans and mice
  JOURNAL   Proc Natl Acad Sci U S A 115 (51), 13021-13026 (2018)
   PUBMED   30487221
REFERENCE   5  (bases 1 to 1550)
  AUTHORS   Soares-Dos-Reis,R., Pessoa,A.S., Dias,A.F., Falcao,M., Matos,M.R.,
            Vitorino,R., Monteiro,F.A., Lima,D. and Reguenga,C.
  TITLE     A role for prolyl isomerase PIN1 in the phosphorylation-dependent
            modulation of PRRXL1 function
  JOURNAL   Biochem J 474 (5), 683-697 (2017)
   PUBMED   28049756
  REMARK    GeneRIF: The findings provide evidence for a putative novel role of
            PIN1 in the development of the nociceptive system and indicate
            phosphorylation-mediated conformational changes as a mechanism for
            regulating the PRRXL1 role in the process.
            Publication Status: Online-Only
REFERENCE   6  (bases 1 to 1550)
  AUTHORS   Ding,Y.Q., Yin,J., Xu,H.M., Jacquin,M.F. and Chen,Z.F.
  TITLE     Formation of whisker-related principal sensory nucleus-based
            lemniscal pathway requires a paired homeodomain transcription
            factor, Drg11
  JOURNAL   J Neurosci 23 (19), 7246-7254 (2003)
   PUBMED   12917357
  REMARK    GeneRIF: Formation of whisker-related principal sensory
            nucleus-based lemniscal pathway requires Drg11.
REFERENCE   7  (bases 1 to 1550)
  AUTHORS   Muller,T., Brohmann,H., Pierani,A., Heppenstall,P.A., Lewin,G.R.,
            Jessell,T.M. and Birchmeier,C.
  TITLE     The homeodomain factor lbx1 distinguishes two major programs of
            neuronal differentiation in the dorsal spinal cord
  JOURNAL   Neuron 34 (4), 551-562 (2002)
   PUBMED   12062039
REFERENCE   8  (bases 1 to 1550)
  AUTHORS   Gross,M.K., Dottori,M. and Goulding,M.
  TITLE     Lbx1 specifies somatosensory association interneurons in the dorsal
            spinal cord
  JOURNAL   Neuron 34 (4), 535-549 (2002)
   PUBMED   12062038
REFERENCE   9  (bases 1 to 1550)
  AUTHORS   Qian,Y., Shirasawa,S., Chen,C.L., Cheng,L. and Ma,Q.
  TITLE     Proper development of relay somatic sensory neurons and D2/D4
            interneurons requires homeobox genes Rnx/Tlx-3 and Tlx-1
  JOURNAL   Genes Dev 16 (10), 1220-1233 (2002)
   PUBMED   12023301
REFERENCE   10 (bases 1 to 1550)
  AUTHORS   Chen,Z.F., Rebelo,S., White,F., Malmberg,A.B., Baba,H., Lima,D.,
            Woolf,C.J., Basbaum,A.I. and Anderson,D.J.
  TITLE     The paired homeodomain protein DRG11 is required for the projection
            of cutaneous sensory afferent fibers to the dorsal spinal cord
  JOURNAL   Neuron 31 (1), 59-73 (2001)
   PUBMED   11498051
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            CT009541.12.
            
            On Oct 19, 2007 this sequence version replaced NM_001001796.3.
            
            Sequence Note: The RefSeq transcript and protein were derived from
            genomic sequence to make the sequence consistent with the reference
            genome assembly. The genomic coordinates used for the transcript
            record were based on alignments.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: AK039633.1, BC145917.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMN01164138, SAMN01164142
                                           [ECO:0000348]
            ##Evidence-Data-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-138               CT009541.12        162204-162341       c
            139-236             CT009541.12        158275-158372       c
            237-338             CT009541.12        156949-157050       c
            339-517             CT009541.12        154014-154192       c
            518-630             CT009541.12        153815-153927       c
            631-782             CT009541.12        115076-115227       c
            783-1550            CT009541.12        113022-113789       c
FEATURES             Location/Qualifiers
     source          1..1550
                     /organism="Mus musculus"
                     /mol_type="mRNA"
                     /strain="C57BL/6"
                     /db_xref="taxon:10090"
                     /chromosome="14"
                     /map="14 19.4 cM"
     gene            1..1550
                     /gene="Drgx"
                     /gene_synonym="Drg11; Prrxl1"
                     /note="dorsal root ganglia homeobox"
                     /db_xref="GeneID:107751"
                     /db_xref="MGI:MGI:2148204"
     exon            1..138
                     /gene="Drgx"
                     /gene_synonym="Drg11; Prrxl1"
                     /inference="alignment:Splign:2.1.0"
     CDS             105..767
                     /gene="Drgx"
                     /gene_synonym="Drg11; Prrxl1"
                     /note="isoform 2 is encoded by transcript variant 2;
                     paired homeodomain protein DRG11; dorsal root ganglia
                     homeobox protein; paired related homeobox protein-like 1b;
                     homeobox protein DRG11; dorsal root ganglion 11"
                     /codon_start=1
                     /product="dorsal root ganglia homeobox protein isoform 2"
                     /protein_id="NP_001001796.1"
                     /db_xref="CCDS:CCDS26922.1"
                     /db_xref="GeneID:107751"
                     /db_xref="MGI:MGI:2148204"
                     /translation="

MFYFHCPPQLEGTAPFGNHSTGDFDDGFLRRKQRRNRTTFTLQQLEALEAVFAQTHYPDVFTREELAMKINLTEARVQVWFQNRRAKWRKTERGASDQEPGAKEPMAEVTPPPVRNINSPPPGDQTRSKKEALEAQQSLGRTVGPTGPFFPSCLPGTLLNTATYAQALSHVASLKDHFRAMLCSGSFGFRGEQTQQRALTPNLYPFLIDERCSAVDMTQG"

     misc_feature    204..374
                     /gene="Drgx"
                     /gene_synonym="Drg11; Prrxl1"
                     /note="Region: Homeodomain; pfam00046"
                     /db_xref="CDD:459649"
     exon            139..236
                     /gene="Drgx"
                     /gene_synonym="Drg11; Prrxl1"
                     /inference="alignment:Splign:2.1.0"
     exon            237..338
                     /gene="Drgx"
                     /gene_synonym="Drg11; Prrxl1"
                     /inference="alignment:Splign:2.1.0"
     exon            339..517
                     /gene="Drgx"
                     /gene_synonym="Drg11; Prrxl1"
                     /inference="alignment:Splign:2.1.0"
     exon            518..630
                     /gene="Drgx"
                     /gene_synonym="Drg11; Prrxl1"
                     /inference="alignment:Splign:2.1.0"
     exon            631..782
                     /gene="Drgx"
                     /gene_synonym="Drg11; Prrxl1"
                     /inference="alignment:Splign:2.1.0"
     exon            783..1550
                     /gene="Drgx"
                     /gene_synonym="Drg11; Prrxl1"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      

attgctgtttgctttgcagccaggccggagccacgcacaggcacaagtctgccaggccgctaccagccctggtccagccatcagggcccatccgaccgtcggcgatgttttatttccactgtccgccacagctagagggcactgcgccttttgggaaccactctacaggggattttgatgatgggtttcttagaagaaaacagcgcagaaatcgaacgaccttcactcttcagcagctggaagctctggaggcagtctttgcccaaacacactacccagatgtcttcaccagagaagagttagccatgaaaataaacctcacagaagccagagtgcaggtttggttccagaaccgaagagccaaatggaggaagacagagagaggggcctctgaccaggagccaggggccaaggaacccatggcagaggtgacaccaccgccagtgaggaacatcaactctccacccccaggggaccagacccggagcaagaaggaggccctggaggcccagcagagcctgggacgcacagtgggccctaccgggcctttcttcccctcctgcttgccagggaccctcctgaacacagccacgtatgcccaggccctgtcccatgtggcatctctgaaagatcatttccgagcaatgctatgttctggaagctttgggttcagaggggaacagacccaacagagagccttaactccaaacctgtaccctttcttgatagacgagagatgctcagcagtagatatgacacaaggatgaactgtatcatgttaggaacccctggaggctagaagagggcattggatcctctggagctggaactgtaggtgactttaagctatcgggtatggttgctgggaactgaagtcaggtcctctggaagagcggcaaatgctcttgaccttggagacatcaccatatcgccatcattttcttacatgcttgtagatgacagccacactgtgtggactagttacatttctgacagacagtggaccagaaagctgttgtcatccagccctatcaacacttgggattgtcagaatttataattttgctaacccacccttacgtcctctgcttcctcgctctcatttctttctttcctgttttgagctggggatctaactcaggacactagttcagctcaactgctgaactacactctgcctaaaaggacttttttttagtattcgaaactgtttcctcctctctcttcttgcctgggtagtttctagtgatcagctggctgtaagttttacctttgacctttattttttttttttagatgcactgtaaggtgtccatctactatggctgtcaaaaaattcccctttctatttgttggcaagagtttcatttacatttattttacttacggcttactgaacttcttggatctctaaatttacagttattattaaatttgaaagaaaacccccaatatcccatctctatttttctcttatctttttccctcctttatttgtaatttcagtcaaatatatattaaattacataacaggccactgctgctgttaa

//