2024-05-19 12:58:50, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_001879458 411 bp mRNA linear PLN 13-NOV-2023 DEFINITION Laccaria bicolor S238N-H82 uncharacterized protein (LACBIDRAFT_325715), partial mRNA. ACCESSION XM_001879458 VERSION XM_001879458.1 DBLINK BioProject: PRJNA29019 BioSample: SAMN02769624 KEYWORDS RefSeq. SOURCE Laccaria bicolor S238N-H82 ORGANISM Laccaria bicolor S238N-H82 Eukaryota; Fungi; Dikarya; Basidiomycota; Agaricomycotina; Agaricomycetes; Agaricomycetidae; Agaricales; Agaricineae; Hydnangiaceae; Laccaria. REFERENCE 1 (bases 1 to 411) AUTHORS Martin,F., Aerts,A., Ahren,D., Brun,A., Danchin,E.G., Duchaussoy,F., Gibon,J., Kohler,A., Lindquist,E., Pereda,V., Salamov,A., Shapiro,H.J., Wuyts,J., Blaudez,D., Buee,M., Brokstein,P., Canback,B., Cohen,D., Courty,P.E., Coutinho,P.M., Delaruelle,C., Detter,J.C., Deveau,A., DiFazio,S., Duplessis,S., Fraissinet-Tachet,L., Lucic,E., Frey-Klett,P., Fourrey,C., Feussner,I., Gay,G., Grimwood,J., Hoegger,P.J., Jain,P., Kilaru,S., Labbe,J., Lin,Y.C., Legue,V., Le Tacon,F., Marmeisse,R., Melayah,D., Montanini,B., Muratet,M., Nehls,U., Niculita-Hirzel,H., Oudot-Le Secq,M.P., Peter,M., Quesneville,H., Rajashekar,B., Reich,M., Rouhier,N., Schmutz,J., Yin,T., Chalot,M., Henrissat,B., Kues,U., Lucas,S., Van de Peer,Y., Podila,G.K., Polle,A., Pukkila,P.J., Richardson,P.M., Rouze,P., Sanders,I.R., Stajich,J.E., Tunlid,A., Tuskan,G. and Grigoriev,I.V. TITLE The genome of Laccaria bicolor provides insights into mycorrhizal symbiosis JOURNAL Nature 452 (7183), 88-92 (2008) PUBMED 18322534 REFERENCE 2 (bases 1 to 411) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (12-NOV-2023) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 3 (bases 1 to 411) AUTHORS Zhou,K., Detter,J.C., Glavina del Rio,T., Dahlen,E., Tice,H., Pitluck,S., Aerts,A., Salamov,A., Shapiro,H.J., Lindquist,E., Lucas,S., Richardson,P.M., Ahren,D., Blaudez,D., Brun,A., Buee,M., Chalot,M., Courty,P., Coutinho,P.M., Deveau,A., Duplessis,S., Duchaussoy,F., Fourrey,C., Fraissinet-Tachet,L., Henrissat,B., Gay,G., Gibon,J., Hoegger,P., Kohler,A., Kues,U., Labbe,J., Muratet,M., Marmeisse,R., Melayah,D., Montanini,B., Napoli,C., Podila,G., Reich,M., Rouhier,N., Rouze,P., Wuyts,J., Martin,F. and Grigoriev,I.V. CONSRTM US DOE Joint Genome Institute (JGI-PGF) TITLE Direct Submission JOURNAL Submitted (19-NOV-2007) US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA 94598-1698, USA COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NW_001889879). COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..411 /organism="Laccaria bicolor S238N-H82" /mol_type="mRNA" /strain="S238N-H82" /db_xref="taxon:486041" /chromosome="Unknown" gene <1..>411 /locus_tag="LACBIDRAFT_325715" /db_xref="GeneID:6074951" CDS 1..411 /locus_tag="LACBIDRAFT_325715" /codon_start=1 /product="uncharacterized protein" /protein_id="XP_001879493.1" /db_xref="GeneID:6074951" /translation="
MYSRSPWPVASPAAPLSSGNQSLLVIHGELPLASVLKYLDENCVDETNIVDGDTDVVNGDADVVNGDADVVNGDTDVDGDVDVVGVDTDGGTDVVDDDTNGGTDVVDGGTDTVGGDTDVEVEQSVRRPGREMIARA"
ORIGIN
atgtactctcggtctccatggcctgttgcatctcctgctgcaccactctcaagtggtaatcaatctcttcttgtcattcacggcgaacttcctcttgcctctgttctcaagtatttggatgagaattgtgtcgatgagaccaacattgtcgatggtgacacagacgtcgtcaatggtgacgcagacgtcgtcaatggtgacgcagatgtcgtcaatggtgacacagacgtcgacggtgatgtagacgtcgtcggtgttgacacagatggtggcacagacgtcgtcgatgatgacacaaatggtggcacagacgttgttgatggtggcacagacactgttggaggtgacacagacgtcgaggttgagcaaagtgtgagacgccctggaagggagatgattgcaagagcgtag
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]