2024-05-19 15:44:02, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_001107931 4016 bp mRNA linear ROD 15-JUL-2023 DEFINITION Rattus norvegicus caveolae associated protein 4 (Cavin4), mRNA. ACCESSION NM_001107931 XM_001055709 XM_232981 VERSION NM_001107931.3 KEYWORDS RefSeq; RefSeq Select. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. REFERENCE 1 (bases 1 to 4016) AUTHORS Malette J, Degrandmaison J, Giguere H, Berthiaume J, Frappier M, Parent JL, Auger-Messier M and Boulay G. TITLE MURC/CAVIN-4 facilitates store-operated calcium entry in neonatal cardiomyocytes JOURNAL Biochim Biophys Acta Mol Cell Res 1866 (8), 1249-1259 (2019) PUBMED 30951783 REMARK GeneRIF: study provides novel evidence that MURC regulates SOCE by interacting with STIM1 in cardiomyocytes. In addition, we identified a first potential mechanism by which the R140W mutation of MURC may contribute to calcium mishandling and the development of cardiomyopathies. REFERENCE 2 (bases 1 to 4016) AUTHORS Naito D, Ogata T, Hamaoka T, Nakanishi N, Miyagawa K, Maruyama N, Kasahara T, Taniguchi T, Nishi M, Matoba S and Ueyama T. TITLE The coiled-coil domain of MURC/cavin-4 is involved in membrane trafficking of caveolin-3 in cardiomyocytes JOURNAL Am J Physiol Heart Circ Physiol 309 (12), H2127-H2136 (2015) PUBMED 26497963 REMARK GeneRIF: MURC/cavin-4 requires its coiled-coil domain to target the plasma membrane and to stabilize Cav3 at the plasma membrane of cardiomyocytes REFERENCE 3 (bases 1 to 4016) AUTHORS Ogata T, Naito D, Nakanishi N, Hayashi YK, Taniguchi T, Miyagawa K, Hamaoka T, Maruyama N, Matoba S, Ikeda K, Yamada H, Oh H and Ueyama T. TITLE MURC/Cavin-4 facilitates recruitment of ERK to caveolae and concentric cardiac hypertrophy induced by alpha1-adrenergic receptors JOURNAL Proc Natl Acad Sci U S A 111 (10), 3811-3816 (2014) PUBMED 24567387 REFERENCE 4 (bases 1 to 4016) AUTHORS Rodriguez G, Ueyama T, Ogata T, Czernuszewicz G, Tan Y, Dorn GW 2nd, Bogaev R, Amano K, Oh H, Matsubara H, Willerson JT and Marian AJ. TITLE Molecular genetic and functional characterization implicate muscle-restricted coiled-coil gene (MURC) as a causal gene for familial dilated cardiomyopathy JOURNAL Circ Cardiovasc Genet 4 (4), 349-358 (2011) PUBMED 21642240 REFERENCE 5 (bases 1 to 4016) AUTHORS Hansen CG, Bright NA, Howard G and Nichols BJ. TITLE SDPR induces membrane curvature and functions in the formation of caveolae JOURNAL Nat Cell Biol 11 (7), 807-814 (2009) PUBMED 19525939 REFERENCE 6 (bases 1 to 4016) AUTHORS Ogata T, Ueyama T, Isodono K, Tagawa M, Takehara N, Kawashima T, Harada K, Takahashi T, Shioi T, Matsubara H and Oh H. TITLE MURC, a muscle-restricted coiled-coil protein that modulates the Rho/ROCK pathway, induces cardiac dysfunction and conduction disturbance JOURNAL Mol Cell Biol 28 (10), 3424-3436 (2008) PUBMED 18332105 REMARK GeneRIF: MURC modulates RhoA signaling, and MURC plays an important role in the development of cardiac dysfunction and conduction disturbance with increased vulnerability to atrial arrhythmias. COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from JACYVU010000161.1. On Aug 30, 2022 this sequence version replaced NM_001107931.2. ##Evidence-Data-START## Transcript exon combination :: SRR8487230.73354.1, EU487255.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMEA5760383, SAMEA5760384 [ECO:0000348] ##Evidence-Data-END## ##RefSeq-Attributes-START## RefSeq Select criteria :: based on single protein-coding transcript ##RefSeq-Attributes-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-477 JACYVU010000161.1 38421035-38421511 478-4016 JACYVU010000161.1 38428268-38431806 FEATURES Location/Qualifiers source 1..4016 /organism="Rattus norvegicus" /mol_type="mRNA" /strain="BN" /db_xref="taxon:10116" /chromosome="5" /map="5q22" gene 1..4016 /gene="Cavin4" /gene_synonym="RGD1310395" /note="caveolae associated protein 4" /db_xref="GeneID:313225" /db_xref="RGD:1310395" exon 1..477 /gene="Cavin4" /gene_synonym="RGD1310395" /inference="alignment:Splign:2.1.0" misc_feature 22..24 /gene="Cavin4" /gene_synonym="RGD1310395" /note="upstream in-frame stop codon" CDS 70..1158 /gene="Cavin4" /gene_synonym="RGD1310395" /note="muscle-related coiled-coil protein; muscle-restricted coiled-coil protein" /codon_start=1 /product="caveolae-associated protein 4" /protein_id="NP_001101401.1" /db_xref="GeneID:313225" /db_xref="RGD:1310395" /translation="
MEHNGSASNAGKIHQNRLSSVTEDEDQDAALTIVTVLDRVATVVDSVQASQKRIEERHREMGNAIKSVQIDLLKLSQSHSNTGYVVNKLFEKTRKVSAHIKDVKARVEKQQVRVTKVETKQEEIMKKNKFRVVIFQEDVPCPASLSVVKDRSLPENEEEAEEVFDPPIDLSSDEEYYVEESRSARLRKSGKEHIDHIKKAFSKENMQKTRQNFDKKVSGIRTRIVTPERRERLRQSGERLRQSGERLRQSGERFKKSISNATPSKEAFKIRSLRKPKDPKAEGQEVDRGMGVDIISGSLALGPIHEFHSDGFSETEKEVTKVGYIPQEGGDPPTPEPLKVTFKPQVRVEDDESLLLELKQSS"
misc_feature 70..141 /gene="Cavin4" /gene_synonym="RGD1310395" /note="propagated from UniProtKB/Swiss-Prot (B1PRL5.1); Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite" misc_feature 148..858 /gene="Cavin4" /gene_synonym="RGD1310395" /note="PTRF/SDPR family; Region: PTRF_SDPR; pfam15237" /db_xref="CDD:434559" misc_feature 523..525 /gene="Cavin4" /gene_synonym="RGD1310395" /note="Phosphoserine. /evidence=ECO:0007744|PubMed:22673903; propagated from UniProtKB/Swiss-Prot (B1PRL5.1); phosphorylation site" misc_feature 580..582 /gene="Cavin4" /gene_synonym="RGD1310395" /note="Phosphoserine. /evidence=ECO:0007744|PubMed:22673903; propagated from UniProtKB/Swiss-Prot (B1PRL5.1); phosphorylation site" misc_feature 583..585 /gene="Cavin4" /gene_synonym="RGD1310395" /note="Phosphoserine. /evidence=ECO:0007744|PubMed:22673903; propagated from UniProtKB/Swiss-Prot (B1PRL5.1); phosphorylation site" misc_feature 748..852 /gene="Cavin4" /gene_synonym="RGD1310395" /note="propagated from UniProtKB/Swiss-Prot (B1PRL5.1); Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite" misc_feature 1039..1041 /gene="Cavin4" /gene_synonym="RGD1310395" /note="Phosphotyrosine. /evidence=ECO:0000250|UniProtKB:A2AMM0; propagated from UniProtKB/Swiss-Prot (B1PRL5.1); phosphorylation site" misc_feature 1069..1071 /gene="Cavin4" /gene_synonym="RGD1310395" /note="Phosphothreonine. /evidence=ECO:0007744|PubMed:22673903; propagated from UniProtKB/Swiss-Prot (B1PRL5.1); phosphorylation site" misc_feature 1126..1128 /gene="Cavin4" /gene_synonym="RGD1310395" /note="Phosphoserine. /evidence=ECO:0000250|UniProtKB:A2AMM0; propagated from UniProtKB/Swiss-Prot (B1PRL5.1); phosphorylation site" exon 478..4016 /gene="Cavin4" /gene_synonym="RGD1310395" /inference="alignment:Splign:2.1.0" ORIGIN
gccgacttttggctccgagtgtaggagccgatcgctgtaggacatcttctgctgagaaaaaaaagtaaaatggaacacaatggatctgcttcaaatgctggtaaaatccaccagaaccgattgtcaagtgtgactgaagatgaagaccaggacgcagctctcacaattgtgactgtgctggacagggtggccaccgtcgtggacagcgtgcaggcaagccagaagagaatcgaggagagacacagagagatggggaacgccatcaagtctgtccagatagacctgctgaagctctcacaatcacacagcaacacgggctacgttgttaacaagctgtttgagaagacccggaaagtcagcgctcacattaaagatgtgaaggcccgggtagagaagcaacaggttcgagtaaccaaagtcgaaaccaagcaagaagaaataatgaagaagaacaagttccgcgtggtaatcttccaggaggatgttccctgccccgcatccctgtctgttgttaaagacagaagcctgccggagaacgaggaggaagctgaggaagtcttcgatcccccgatcgatctctcatcggatgaagaatactatgttgaagaaagcagatctgccaggcttagaaagtcaggcaaagagcacatcgatcatattaagaaggcattttccaaagaaaacatgcagaagacgcggcagaattttgataagaaagtgagtggaattagaaccaggatagttacacctgagagaagagagaggctgaggcagtcaggagagaggctgaggcagtcgggggagaggctgaggcagtcgggggaaagatttaagaaatcgatctcaaatgccaccccctccaaggaagcttttaagatccggagccttagaaaaccgaaggaccccaaggcggaaggccaggaggtagacagggggatgggggtggacatcatctcaggtagcctggctctggggcccatccatgagttccactctgatgggttcagtgaaacagaaaaggaggtgaccaaagtagggtacattccccaagagggaggggaccccccaacgcctgagcctttgaaggtgacctttaaacctcaggtgagagtagaggatgacgagtcactcctgttggaattaaagcagtcctcatagaggacttgagtgtgagcatcagtcacttcgaatcatgtggtcgtagtttgaagggtacagtaatttacattcatgcacagtgggaaggcaaatggtataaaagcttcatttcttacctttaaaatcctagagatgatggaaatattatatacagttttcttataatttccttgggaattctatttcccctgagaatatatgactctgacagcttccccctcatccccgcttatgtcatgcctttccatgggaggtcttggccaatgagaaaatagtcggatggctcaggtcacttagatgcttggtcatttgtaacacgggaacgacacatctgtgcccattggtcaccaacaaagcatacattagggtcaggattaacacttccagtttcaaaggggagtagctaatgtgtacattgtgttatccagatgtttacatctggagattcattagtgaatcagtagccttatgaagctcctgaagtccttgtgtgagggaaaggaaatagaagtttggggcctgaacgtttagctgtggcaacgtaactttattactagtgagacacttggctggctgcccctcgttctcaataggaaaaatggtgaggcttcgtacttctcagaggacttgagatctgagggtatgtcacagagtgtgggagaacaagacacacaaccagtggagaagcgtgaaccacactggccttccctaaaccagaactgaacagttacatctctgcagaagcccttggcacaggctctgaggccagagttgagcagaaactgagtttgttcttcacaagtcttcactgcacgcacagtgaaaaatgaacgcttggatgggtgctttctcattgaaggctgagaccaaaccttgggttttagccgtgtcctaacatgttccttggaagactggctccatttgccggtagatttggatgtggggtagacaagtacaggtcttgtttgcccagcacgaggtagaagtctggaacacggttgtcaagtggcttttccacggtccgccctggtgtgccgctgggcacagaaacaaccccgacacttctgtttgccagagcggactgagaacagtgcccataagctttcgtcagggccacgcggagggcgtccaattccagttagctcttagatctagatctgggtagtcaagaggtaactattgctgcttccagcacacggaaatcttgggggcattttcttgatatggaagagatggtagaatttttgataagttcgtttaaactcacatttagtttaatttttgaataatcatgtagtacttaaatatatgcaggcttgggggtgcgtgcctgctgccccagcactagcaaggctgaaacaggatcgcagtgaagctgagtgagcctgggctccctttatatacacagttcagtatactttccttttctcttggcctgaatacgtgttcatcttgctatctcttttttatttgtttgttttctttcctcctcctccttctcttctttggtttgtttgtttgcttgcttgtttgtgttttcaagatggggtttctctgtgtagtcctggaacttgctctgtggaccaggctggcctcttaactcacagagacccgcttgccccccctcccgagggctgggtttaaaggggtgtaacaccatcacacggcatcctgctaccttttttatactgcaaactaaagcatgtgtagcattgaataacactttaagagaataattccaaacacattttttttataacagcttagaaggaggttaacggtgtctaagaataagtttgaatgtgaaatgatgttgttgcaaaatgcgaggccggtgttgtggttgttaatcttttaaccagtgatgagtggtaactgcaatatgcaaatggagaaagagttaaccaatggtaaatcaaggctcgagggaatacagagaagttacagacgtggtacgtcgagggcaggaggaatgtcgagaagttacagttgttgttttcagtttatttcatttggtctaaaatacttttctgcaaatgtctagggctttgtccactagtcattaatgtccggctctgacagcttagaaagcattgcacctgtagccatattagagtctgactgggaaggagttacgacctggccagccagctctttgtcttgctagagtttgacaccagaaccaccggatgtttcctgttgctgaccgctcatgtaatcccatgcttccttctcaccgtcagggtttcccctccatgttgtgaacatgtgtcctttcatgtttaggacattcctgaattccacattcacagtctcttgtacctcctacctgctttcatggctcggagatgatgggctgcaaaagtcactcactctcttaacacaagggcacaagggacgttctagtcagtgttcatcagtttaaaagtctcgggaaatgcccggttgcttgctgatctgtaatgcagcattacgcatcaggctttagataatttacccaaggcaaaccttcagcaggatttgcccccttctagtaatgagatggagcagagcagctgccccagaggccaggggtggggacgctggtgttgaggcttttccaggggacacagtgaagtgaaagcctgtctcctgtgtgtggtgatccagctatcctgagtggccagtggcttggcccctgcttacaggttatagagaaatgaactcgggtgttccgcttgccgacagtggacttgtgtgtgttcccccaaaagcaagttttcatgagtgaaaagtacaagctgccaaagtaaaaagccaaccatattgccttccttctttgcctttcatattcattaaagatgtcagtttggaacagg
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]