2025-07-16 04:30:26, GGRNA.v2 : RefSeq release 229 (Mar, 2025)
LOCUS XM_054341721 781 bp mRNA linear PRI 26-AUG-2024 DEFINITION PREDICTED: Homo sapiens ciliary microtubule inner protein 2C (CIMIP2C), transcript variant X9, mRNA. ACCESSION XM_054341721 VERSION XM_054341721.1 DBLINK BioProject: PRJNA807723 KEYWORDS RefSeq; includes ab initio. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_060926) annotated using gene prediction method: Gnomon, supported by EST evidence. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Updated annotation Annotation Name :: GCF_009914755.1-RS_2024_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Best-placed RefSeq; Gnomon; RefSeqFE; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/23/2024 ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 2% of CDS bases ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..781 /organism="Homo sapiens" /mol_type="mRNA" /isolate="CHM13" /db_xref="taxon:9606" /chromosome="2" /sex="female" /cell_line="CHM13htert" /tissue_type="hydatidiform mole" /note="haploid cell line" gene 1..781 /gene="CIMIP2C" /gene_synonym="C2orf70; FAM166C" /note="ciliary microtubule inner protein 2C; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 ESTs, 13 long SRA reads, and 98% coverage of the annotated genomic feature by RNAseq alignments, including 7 samples with support for all annotated introns" /db_xref="GeneID:339778" /db_xref="HGNC:HGNC:27938" CDS 258..695 /gene="CIMIP2C" /gene_synonym="C2orf70; FAM166C" /codon_start=1 /product="ciliary microtubule inner protein 2C isoform X7" /protein_id="XP_054197696.1" /db_xref="GeneID:339778" /db_xref="HGNC:HGNC:27938" /translation="
MEKSHTPFSQGGHFPTIFSTNPNLLLMERASTRDRWLHKPSYTRFNLDSHRSTELTNFYQMVQQHRKYYQDKTGTVPRVPYFAMPVREPERYPLPTVLPPLCPKKKWHLLRLAPENLKTYQTFPSGKRVSPQERKKRDCYFEFRA"
misc_feature <258..344 /gene="CIMIP2C" /gene_synonym="C2orf70; FAM166C" /note="Protein of unknown function (DUF2475); Region: DUF2475; pfam10629" /db_xref="CDD:431404" ORIGIN
aggctcgctgtactcgcgcacccaccatggcctcccgcagcgcgggcaccctactgaccgagttcaatgccgcctacgtgccccctggactcatgcccgggcagcgcccgttctgttggtgaggagaccgaggcccaaggcacagggaaagaccccagaagaggtaccagggccacgtccccactgtggccttctcctttggcgctccctacggcaccaccaccctcaagtacttccaggaccaccgcaacagagccatggagaagagccacactcccttcagccaaggcggccatttccccaccatcttctccaccaaccccaacctcctgctgatggagcgcgccagcacccgggaccgctggctgcacaagcccagctacactcgcttcaacctggacagccatcgctccacagagcttacgaatttctaccagatggtccagcagcatcggaagtactatcaagacaagacgggcacagtgcctcgagtcccctactttgcgatgcccgtgagggagccggaacggtaccccctccccaccgtcctgcctcctctgtgcccaaagaagaagtggcaccttttaagactagcccccgagaacctgaagacctaccagaccttcccatcagggaagagggtctctccacaggagcggaaaaagagagactgctactttgagttcagagcatgagacttttagttcagagcagagcctgatgcctgagatcctgggtcgtgaccagcctggcttgcttggaataaaatctttagccatga
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]