2024-05-03 05:39:36, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_054327869 551 bp mRNA linear PRI 05-OCT-2023 DEFINITION PREDICTED: Homo sapiens S100 calcium binding protein G (S100G), transcript variant X1, mRNA. ACCESSION XM_054327869 VERSION XM_054327869.1 DBLINK BioProject: PRJNA807723 KEYWORDS RefSeq; includes ab initio. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_060947) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Updated annotation Annotation Name :: GCF_009914755.1-RS_2023_10 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.2 Annotation Method :: Best-placed RefSeq; Gnomon; RefSeqFE; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 10/02/2023 ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 5% of CDS bases ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..551 /organism="Homo sapiens" /mol_type="mRNA" /isolate="CHM13" /db_xref="taxon:9606" /chromosome="X" /sex="female" /cell_line="CHM13htert" /tissue_type="hydatidiform mole" /note="haploid cell line" gene 1..551 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /note="S100 calcium binding protein G; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 Proteins, and 97% coverage of the annotated genomic feature by RNAseq alignments, including 5 samples with support for all annotated introns" /db_xref="GeneID:795" /db_xref="HGNC:HGNC:1436" /db_xref="MIM:302020" CDS 151..390 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /codon_start=1 /product="protein S100-G isoform X1" /protein_id="XP_054183844.1" /db_xref="GeneID:795" /db_xref="HGNC:HGNC:1436" /db_xref="MIM:302020" /translation="
MSTKKSPEELKRIFEKYAAKEGDPDQLSKDELKLLIQAEFPSLLKGPNTLDDLFQELDKNGDGEVSFEEFQVLVKKISQ"
misc_feature 184..387 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /note="S-100 domain, which represents the largest family within the superfamily of proteins carrying the Ca-binding EF-hand motif. Note that this S-100 hierarchy contains only S-100 EF-hand domains, other EF-hands have been modeled separately. S100 proteins are...; Region: S-100; cd00213" /db_xref="CDD:238131" misc_feature order(202..204,217..219,226..228,241..246,322..324, 328..330,334..336,340..342,346..348,355..357) /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /note="Ca2+ binding site [ion binding]; other site" /db_xref="CDD:238131" ORIGIN
aaactcctctttgattcttctagctgtttcactattgggcaaccaggaaatggcccaatggcactaaaatcctgcagacaaccctcagcacaaaactgtacttcagctttttggtaagtttattttcttcccaatttataagacaccagaatgagtactaaaaagtctcctgaggaactgaagaggatttttgaaaaatatgcagccaaagaaggtgatccagaccagttgtcaaaggatgaactgaagctattgattcaggctgaattccccagtttactcaaaggtccaaacaccctagatgatctctttcaagaactggacaagaatggagatggagaagttagttttgaagaattccaagtattagtaaaaaagatatcccagtgaaggagaaaacaaaatagaaccctgagcactggaggaagagcgcctgtgctgtggtcttatcctatgtggaatcccccaaagtctctggtttaattctttgcaattataataacctggctgtgaggttcagttattattaataaagaaattattagacatac
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]