2024-11-01 11:31:09, GGRNA.v2 : RefSeq release 226 (Sep, 2024)
LOCUS XM_047447083 1917 bp mRNA linear PRI 26-AUG-2024 DEFINITION PREDICTED: Homo sapiens double homeobox protein 4-like (LOC124908466), mRNA. ACCESSION XM_047447083 VERSION XM_047447083.1 DBLINK BioProject: PRJNA807723 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_060946) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Updated annotation Annotation Name :: GCF_009914755.1-RS_2024_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Best-placed RefSeq; Gnomon; RefSeqFE; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/23/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1917 /organism="Homo sapiens" /mol_type="mRNA" /isolate="CHM13" /db_xref="taxon:9606" /chromosome="22" /sex="female" /cell_line="CHM13htert" /tissue_type="hydatidiform mole" /note="haploid cell line" gene 1..1917 /gene="LOC124908466" /note="double homeobox protein 4-like; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 long SRA reads, and 30% coverage of the annotated genomic feature by RNAseq alignments, including 6 samples with support for all annotated introns" /db_xref="GeneID:124908466" CDS 1131..1871 /gene="LOC124908466" /codon_start=1 /product="double homeobox protein 4-like" /protein_id="XP_047303039.1" /db_xref="GeneID:124908466" /translation="
MPCAPGALPQGAFVSQAARAIPLLQPSQAAQAEGLSQPARACGALCSLPWLLRNWCSSILRLPGSLRTPTNDRKTRTRSATSFWVRAQWDSLGPLKLSHRGKVCLRHPCPTGVRGGAGATGRQGGVGTRRRGTSTSRARDPGGLRVKHRCQPSRRLPTAPGPGLSSALTSSLLDELLSIPKFQQKAQSFLDPAPLGELKDLEEHALLEPLLSQEEHRALLEEQLTCLGSLSSRSSERLHTEEGCQE"
ORIGIN
aaggattgctattaaggacatttgtgattcatgggaggaggttcaaatatcatgaagggattaatggtgaatcctttccaaaaggttttcaattcagtttatccagattcatcaaagaaatcactatctatgacagctatacctttacaaaatgcatttattaattaataaaaacacttgaaagtcaaaaccactccttgatccacaggctgaaggtaaatattgtattagcagtcatgaaaataacattaatttccaagtacatctccatctaagcttctggatagctaggtgaattgtcaataaacagcaatcttttttcctttttctttttctttacttttattttttctttttcttttcttcttttttttttttgttggacgtagtttcgctcttgttgcccaggcttgagtgcagtggtgcggtctcggctcactgcaacctctgcctccagggttcaagccattgttctgcctcagcctcccgagtggctgaaattacaggtactaccactatgcctggctaatgtttttgtatttttagtagagatggggtttcatcattttggccaggctggtcttgaactcctgacctcaggtgatcctcggcctcccaaagtgcagggattacaggtgtgagccactatgcctggccaagcaacagtctttttaaaggaatctttttttttttttttctgagcagtaggtctcaatagtgggattaatatattcagtaaaccatgctattaacagatgtgctgtcacccagacagtgatgttccatttctagagcacagaaagaatagattttgcataattcttaagggtcctgagattttcagagtggtcaatgagcactggctgtaacttaaagtcaccagctgcagtggtcctcaaagaagttttgaagccaagcattgacttctctctagctatgaaaattctacatcttcactaggcttaatcatttctagctctggacttaaagtgagagacgtacaagtcttcctttcatttgagttctttgaagccactgtggttactaattagcacccccggtgggtgtcaccctcctctatcgagttcacccacaccggggcgtggggaaccgctcttcccacaacccacatgccctgcgcgcctggggctctcccacagggggctttcgtgagccaggcagcaagggccatcccgctgctccaacccagccaggctgcgcaggcagaaggactctcccaacctgcccgggcatgcggggctttgtgttcgctgccctggctcctccggaactggtgctcttccatcctcagactccctggtagtctccgcaccccaacaaatgacaggaagaccagaacccgcagcgcgacgtccttctgggtgcgtgctcagtgggacagcttgggccccctcaagctgagtcacaggggcaaggtgtgcttgcgccacccatgtcccaccggagtacgtggtggggctggagccacaggtcgccagggtggcgtgggaacccgaagacggggcacctccacctccagagctcgcgaccccggaggcctccgtgtcaagcacagatgccagccatccaggcgcctcccaacagctccaggaccggggctctcatctgcactcacctccagcctgttagatgagctcctgtcaatcccaaagtttcagcaaaaggctcaatctttcctagatccggcgccactcggggagctgaaggacctggaagagcacgctttgctggaaccactcctcagccaggaagaacacagggctcttctggaggagcagctgacctgcctaggatccctgagttccaggtccagcgagagactccacacagaggagggctgtcaagaatgacaagaaagaattcctgagcatcccagggatcccagggccggtccag
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]