GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-18 16:04:15, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       NM_001414023            2179 bp    mRNA    linear   PRI 25-DEC-2023
DEFINITION  Homo sapiens epoxide hydrolase 2 (EPHX2), transcript variant 12,
            mRNA.
ACCESSION   NM_001414023
VERSION     NM_001414023.1
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 2179)
  AUTHORS   Pu Y, Cheng R, Zhang Q, Huang T, Lu C, Tang Z, Zhong Y, Wu L,
            Hammock BD, Hashimoto K, Luo Y and Liu Y.
  TITLE     Role of soluble epoxide hydrolase in the abnormal activation of
            fibroblast-like synoviocytes from patients with rheumatoid
            arthritis
  JOURNAL   Clin Immunol 257, 109850 (2023)
   PUBMED   38013165
  REMARK    GeneRIF: Role of soluble epoxide hydrolase in the abnormal
            activation of fibroblast-like synoviocytes from patients with
            rheumatoid arthritis.
REFERENCE   2  (bases 1 to 2179)
  AUTHORS   Gao L, Chen W, Li L, Li J, Kongling W, Zhang Y, Yang X, Zhao Y, Bai
            J and Wang F.
  TITLE     Targeting soluble epoxide hydrolase promotes osteogenic-angiogenic
            coupling via activating SLIT3/HIF-1alpha signalling pathway
  JOURNAL   Cell Prolif 56 (7), e13403 (2023)
   PUBMED   36636821
  REMARK    GeneRIF: Targeting soluble epoxide hydrolase promotes
            osteogenic-angiogenic coupling via activating SLIT3/HIF-1alpha
            signalling pathway.
REFERENCE   3  (bases 1 to 2179)
  AUTHORS   Padhy B, Kapuganti RS, Hayat B, Mohanty PP and Alone DP.
  TITLE     Wide-spread enhancer effect of SNP rs2279590 on regulating epoxide
            hydrolase-2 and protein tyrosine kinase 2-beta gene expression
  JOURNAL   Gene 854, 147096 (2023)
   PUBMED   36470481
  REMARK    GeneRIF: Wide-spread enhancer effect of SNP rs2279590 on regulating
            epoxide hydrolase-2 and protein tyrosine kinase 2-beta gene
            expression.
REFERENCE   4  (bases 1 to 2179)
  AUTHORS   Sato K, Emi M, Ezura Y, Fujita Y, Takada D, Ishigami T, Umemura S,
            Xin Y, Wu LL, Larrinaga-Shum S, Stephenson SH, Hunt SC and Hopkins
            PN.
  TITLE     Soluble epoxide hydrolase variant (Glu287Arg) modifies plasma total
            cholesterol and triglyceride phenotype in familial
            hypercholesterolemia: intrafamilial association study in an
            eight-generation hyperlipidemic kindred
  JOURNAL   J Hum Genet 49 (1), 29-34 (2004)
   PUBMED   14673705
REFERENCE   5  (bases 1 to 2179)
  AUTHORS   Sandberg M and Meijer J.
  TITLE     Structural characterization of the human soluble epoxide hydrolase
            gene (EPHX2)
  JOURNAL   Biochem Biophys Res Commun 221 (2), 333-339 (1996)
   PUBMED   8619856
REFERENCE   6  (bases 1 to 2179)
  AUTHORS   Larsson C, White I, Johansson C, Stark A and Meijer J.
  TITLE     Localization of the human soluble epoxide hydrolase gene (EPHX2) to
            chromosomal region 8p21-p12
  JOURNAL   Hum Genet 95 (3), 356-358 (1995)
   PUBMED   7868134
REFERENCE   7  (bases 1 to 2179)
  AUTHORS   Beetham JK, Tian T and Hammock BD.
  TITLE     cDNA cloning and expression of a soluble epoxide hydrolase from
            human liver
  JOURNAL   Arch Biochem Biophys 305 (1), 197-201 (1993)
   PUBMED   8342951
REFERENCE   8  (bases 1 to 2179)
  AUTHORS   Papadopoulos D, Grondal S, Rydstrom J and DePierre JW.
  TITLE     Levels of cytochrome P-450, steroidogenesis and microsomal and
            cytosolic epoxide hydrolases in normal human adrenal tissue and
            corresponding tumors
  JOURNAL   Cancer Biochem Biophys 12 (4), 283-291 (1992)
   PUBMED   1423213
REFERENCE   9  (bases 1 to 2179)
  AUTHORS   Petruzzelli S, Franchi M, Gronchi L, Janni A, Oesch F, Pacifici GM
            and Giuntini C.
  TITLE     Cigarette smoke inhibits cytosolic but not microsomal epoxide
            hydrolase of human lung
  JOURNAL   Hum Exp Toxicol 11 (2), 99-103 (1992)
   PUBMED   1349227
REFERENCE   10 (bases 1 to 2179)
  AUTHORS   Vesell ES.
  TITLE     Genetic factors that regulate cytosolic epoxide hydrolase activity
            in normal human lymphocytes
  JOURNAL   Ann Genet 34 (3-4), 167-172 (1991)
   PUBMED   1809223
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from AF311103.5.
            
            Summary: This gene encodes a member of the epoxide hydrolase
            family. The protein, found in both the cytosol and peroxisomes,
            binds to specific epoxides and converts them to the corresponding
            dihydrodiols. Mutations in this gene have been associated with
            familial hypercholesterolemia. Alternatively spliced transcript
            variants have been described. [provided by RefSeq, Feb 2012].
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: SRR14038194.4220193.1,
                                           SRR14038191.274556.1 [ECO:0000332]
            ##Evidence-Data-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-167               AF311103.5         101026-101192
            168-252             AF311103.5         110809-110893
            253-412             AF311103.5         113487-113646
            413-603             AF311103.5         114839-115029
            604-2179            AF311103.5         116755-118330
FEATURES             Location/Qualifiers
     source          1..2179
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="8"
                     /map="8p21.2-p21.1"
     gene            1..2179
                     /gene="EPHX2"
                     /gene_synonym="ABHD20; CEH; SEH"
                     /note="epoxide hydrolase 2"
                     /db_xref="GeneID:2053"
                     /db_xref="HGNC:HGNC:3402"
                     /db_xref="MIM:132811"
     exon            1..167
                     /gene="EPHX2"
                     /gene_synonym="ABHD20; CEH; SEH"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    28..30
                     /gene="EPHX2"
                     /gene_synonym="ABHD20; CEH; SEH"
                     /note="upstream in-frame stop codon"
     CDS             67..735
                     /gene="EPHX2"
                     /gene_synonym="ABHD20; CEH; SEH"
                     /EC_number="3.3.2.10"
                     /EC_number="3.1.3.76"
                     /note="isoform 11 is encoded by transcript variant 12;
                     epoxide hydrolase 2, cytosolic; epoxide hydrolase,
                     soluble; epoxide hydratase; epoxide hydrolase 2,
                     cytoplasmic; bifunctional epoxide hydrolase 2"
                     /codon_start=1
                     /product="bifunctional epoxide hydrolase 2 isoform 11"
                     /protein_id="NP_001400952.1"
                     /db_xref="GeneID:2053"
                     /db_xref="HGNC:HGNC:3402"
                     /db_xref="MIM:132811"
                     /translation="
MTLRAAVFDLDGVLALPAVFGVLGRTEEALALPRGLLNDAFQKGGPEGATTRLMKGEITLSQWIPLMEENCRKCSETAKVCLPKNFSIKEIFDKAISARKINRPMLQAALMLRKKGFTTAILTNTWLDDRAERDGLAQLMCELKMHFDFLIESCQVGMVKPEPQIYKFLLDTLKASPSEVVFLDDIGANLKPARDLGMVTILVQDTDTALKELEKVTGIQVT"
     misc_feature    73..708
                     /gene="EPHX2"
                     /gene_synonym="ABHD20; CEH; SEH"
                     /note="N-terminal lipase phosphatase domain of human
                     soluble epoxide hydrolase, Escherichia coli YihX/HAD4
                     alpha-D-glucose 1-phosphate phosphatase, and related
                     domains, may be inactive; Region: HAD_sEH-N_like; cd02603"
                     /db_xref="CDD:319790"
     misc_feature    order(91..105,433..438,544..546,616..621,628..633)
                     /gene="EPHX2"
                     /gene_synonym="ABHD20; CEH; SEH"
                     /note="active site"
                     /db_xref="CDD:319790"
     misc_feature    193..195
                     /gene="EPHX2"
                     /gene_synonym="ABHD20; CEH; SEH"
                     /note="N6-acetyllysine.
                     /evidence=ECO:0007744|PubMed:19608861; propagated from
                     UniProtKB/Swiss-Prot (P34913.2); acetylation site"
     misc_feature    529..531
                     /gene="EPHX2"
                     /gene_synonym="ABHD20; CEH; SEH"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:319790"
     misc_feature    637..639
                     /gene="EPHX2"
                     /gene_synonym="ABHD20; CEH; SEH"
                     /note="N6-acetyllysine.
                     /evidence=ECO:0000250|UniProtKB:P34914; propagated from
                     UniProtKB/Swiss-Prot (P34913.2); acetylation site"
     misc_feature    709..711
                     /gene="EPHX2"
                     /gene_synonym="ABHD20; CEH; SEH"
                     /note="N6-acetyllysine.
                     /evidence=ECO:0000250|UniProtKB:P34914; propagated from
                     UniProtKB/Swiss-Prot (P34913.2); acetylation site"
     exon            168..252
                     /gene="EPHX2"
                     /gene_synonym="ABHD20; CEH; SEH"
                     /inference="alignment:Splign:2.1.0"
     exon            253..412
                     /gene="EPHX2"
                     /gene_synonym="ABHD20; CEH; SEH"
                     /inference="alignment:Splign:2.1.0"
     exon            413..603
                     /gene="EPHX2"
                     /gene_synonym="ABHD20; CEH; SEH"
                     /inference="alignment:Splign:2.1.0"
     exon            604..2179
                     /gene="EPHX2"
                     /gene_synonym="ABHD20; CEH; SEH"
                     /inference="alignment:Splign:2.1.0"
     regulatory      2139..2144
                     /regulatory_class="polyA_signal_sequence"
                     /gene="EPHX2"
                     /gene_synonym="ABHD20; CEH; SEH"
                     /note="hexamer: AATAAA"
     regulatory      2144..2149
                     /regulatory_class="polyA_signal_sequence"
                     /gene="EPHX2"
                     /gene_synonym="ABHD20; CEH; SEH"
                     /note="hexamer: ATTAAA"
     polyA_site      2156
                     /gene="EPHX2"
                     /gene_synonym="ABHD20; CEH; SEH"
     polyA_site      2179
                     /gene="EPHX2"
                     /gene_synonym="ABHD20; CEH; SEH"
                     /note="major polyA site"
ORIGIN      
gccctggccttcgcgcatctcccaggttagctgcgtgtccgggtgctaggctgcagacccgccgccatgacgctgcgcgcggccgtcttcgaccttgacggggtgctggcgctgccagcggtgttcggcgtcctcggccgcacggaggaggccctggcgctgcccagaggacttctgaatgatgctttccagaaagggggaccagagggtgccactacccggcttatgaaaggagagatcacactttcccagtggataccactcatggaagaaaactgcaggaagtgctccgagaccgctaaagtctgcctccccaagaatttctccataaaagaaatctttgacaaggcgatttcagccagaaagatcaaccgccccatgctccaggcagctctcatgctcaggaagaaaggattcactactgccatcctcaccaacacctggctggacgaccgtgctgagagagatggcctggcccagctgatgtgtgagctgaagatgcactttgacttcctgatagagtcgtgtcaggtgggaatggtcaaacctgaacctcagatctacaagtttctgctggacaccctgaaggccagccccagtgaggtcgtttttttggatgacatcggggctaatctgaagccagcccgtgacttgggaatggtcaccatcctggtccaggacactgacacggccctgaaagaactggagaaagtgaccggaatccaggtaacttgacttctgagcgagccaagcttcctggactcatctgtggtttctggactcaggagaaaaccacgagcagagaagctgctgtccgtggagtccatgaatgactcctgggcaccgctggttgggagtccatcacccactgtgcagtcagcacgatgtccctaaggagcatcttgcctctttctctgcagtcagtgaacagggagacaagaatttatactagtgttagtgccagggccggggaactggcagcaagagtgggatgttcaaggtcatcctgacctcacttttgagagtaagtatggagaacgtttaccctaaggatcagggcccctacctggcatgtcgagcatgccgctggcactcaggtgcagccctttagttccacccagctcagagggaagcctcttaagaaaagcctgtccgtccctgaggtggttgggacagccatcatgatgtccctggggttgcctggggattagcctgctcctccagttctgaggcacctttcttttttggggttgacctgagatcgctgatctcactgagtccacagccttctgcagaagtgcagcaccctcatcctgtgagcacaggggagaagaggcaggagaaagctggcactcagctgaggctgccacatgtccaaggatgcacagccattgcctcaaagggaagtaggttagtttgctcgggctgccataacaaagtactacaggctgtgtggcttcaacaacagacatgtattttctcactgttctggaggctggaagtccaagatcaaggtgccagcagggttggtttctccagaagcctctctccttggcttgaagacagccactttctccctatttcctcacttggtttttccctgtgtctttctgcttcctaacttcctccttttatgaggatacccgtcagattgcactaggtcccaccctaatgacgtcctttaaccttagttacctctgtaaaggcctaatctccgaatacagtcacattctaaagtattgggggctaaggctgggtgcagtggctcactcctgtaatcacagccctttgggaggccaaggtgggcggatcggttgatgtcaggagttcgagaccaacctggccaacatggctacaaccccgtctctactaaaaatataaaaacttagccaagcatagtggtgggcacctgtaatcccagctgctcgggaagctgaggcacgagaatagcttgaacccaggaggtggaggttgcaatgattcaagatcgtgctactgcatttcaacctggacaacaagagcgagactctgtctccaaaaacaaacaaacaaaaaagtattggcactaagactttaacgtgaattttgagagtgatacagtttagcccatgacaagactgatttttttgtctttagtgaataaattaaaatgtatacccagtgactccataaccttaaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]