LOCUS       NM_204616               2121 bp    mRNA    linear   VRT 23-SEP-2023
DEFINITION  Gallus gallus NK2 homeobox 1 (NKX2-1), transcript variant 1, mRNA.
ACCESSION   NM_204616 XM_015287273
VERSION     NM_204616.2
KEYWORDS    RefSeq.
SOURCE      Gallus gallus (chicken)
  ORGANISM  Gallus gallus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
            Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
            Phasianidae; Phasianinae; Gallus.
REFERENCE   1  (bases 1 to 2121)
  AUTHORS   Tang H, Finn RD and Thomas PD.
  TITLE     TreeGrafter: phylogenetic tree-based annotation of proteins with
            Gene Ontology terms and other annotations
  JOURNAL   Bioinformatics 35 (3), 518-520 (2019)
   PUBMED   30032202
REFERENCE   2  (bases 1 to 2121)
  AUTHORS   Burge S, Kelly E, Lonsdale D, Mutowo-Muellenet P, McAnulla C,
            Mitchell A, Sangrador-Vegas A, Yong SY, Mulder N and Hunter S.
  TITLE     Manual GO annotation of predictive protein signatures: the InterPro
            approach to GO curation
  JOURNAL   Database (Oxford) 2012, bar068 (2012)
   PUBMED   22301074
  REMARK    Publication Status: Online-Only
REFERENCE   3  (bases 1 to 2121)
  AUTHORS   Pera EM and Kessel M.
  TITLE     Demarcation of ventral territories by the homeobox gene NKX2.1
            during early chick development
  JOURNAL   Dev Genes Evol 208 (3), 168-171 (1998)
   PUBMED   9601992
REFERENCE   4  (bases 1 to 2121)
  AUTHORS   Qiu M, Shimamura K, Sussel L, Chen S and Rubenstein JL.
  TITLE     Control of anteroposterior and dorsoventral domains of Nkx-6.1 gene
            expression relative to other Nkx genes during vertebrate CNS
            development
  JOURNAL   Mech Dev 72 (1-2), 77-88 (1998)
   PUBMED   9533954
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            JAENSK010000215.1.
            
            On or before Oct 6, 2021 this sequence version replaced
            XM_015287273.3, NM_204616.1.
            
            ##Evidence-Data-START##
            Transcript exon combination :: SRR12888534.182218.1,
                                           SRR12888537.171340.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMN06140854, SAMN06140855
                                           [ECO:0000348]
            ##Evidence-Data-END##
            COMPLETENESS: full length.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-174               JAENSK010000215.1  7103228-7103401     c
            175-551             JAENSK010000215.1  7098839-7099215     c
            552-2121            JAENSK010000215.1  7096719-7098288     c
FEATURES             Location/Qualifiers
     source          1..2121
                     /organism="Gallus gallus"
                     /mol_type="mRNA"
                     /db_xref="taxon:9031"
                     /chromosome="5"
                     /map="5"
     gene            1..2121
                     /gene="NKX2-1"
                     /gene_synonym="NKX2.1; TITF1"
                     /note="NK2 homeobox 1"
                     /db_xref="CGNC:49266"
                     /db_xref="GeneID:395322"
     exon            1..174
                     /gene="NKX2-1"
                     /gene_synonym="NKX2.1; TITF1"
                     /inference="alignment:Splign:2.1.0"
     CDS             122..1222
                     /gene="NKX2-1"
                     /gene_synonym="NKX2.1; TITF1"
                     /note="isoform 1 is encoded by transcript variant 1;
                     homeodomain protein NKx2.1; thyroid transcription factor
                     1"
                     /codon_start=1
                     /product="homeobox protein Nkx-2.1 isoform 1"
                     /protein_id="NP_989947.2"
                     /db_xref="CGNC:49266"
                     /db_xref="GeneID:395322"
                     /translation="

MLHALSSWRSNWACAAEGRRIMSMSPKHTTPFSVSDILSPLEESYKKVGMEGSNLGAPLSAYRQSQVSQPAMQQHPMGHNGTVTAAYHMTAAGVPQLSHATMGGYCNGNLGNMSELPPYQDTMRNSASATGWYGTNPDPRFSSISRFMAPSSGMNMGGMGGLSSLGDVSKSMAPLQSTPRRKRRVLFSQAQVYELERRFKQQKYLSAPEREHLASMIHLTPTQVKIWFQNHRYKMKRQAKDKAAQQQMQQENGSCQQQQSPRRVAVPVLVKDGKPCQAGSNTPTAAIQSHPQQAATTITVATNGNSLGQHQSHQTNSAGQSPDMGQHSASPSSLQSQVSSLSHLNSSTSDYGTAMSCSTLLYGRTW"

     misc_feature    662..832
                     /gene="NKX2-1"
                     /gene_synonym="NKX2.1; TITF1"
                     /note="Region: Homeodomain; pfam00046"
                     /db_xref="CDD:459649"
     exon            175..551
                     /gene="NKX2-1"
                     /gene_synonym="NKX2.1; TITF1"
                     /inference="alignment:Splign:2.1.0"
     exon            552..2121
                     /gene="NKX2-1"
                     /gene_synonym="NKX2.1; TITF1"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      

ggccgggaacggcccggcagaggaaaagccgggggtcggagcatcgggtcagaagagttcgggcgccagccgggaagtggttcaggagggcaaagcctcgcgagtgggccctgcgtgcgaaatgctccacgccctgagcagctggaggagcaactgggcgtgcgctgcggagggccgccgaatcatgtcgatgagcccaaagcatacgactcctttctcagtgtctgacatcttgagtcctttggaggaaagctacaagaaagtgggcatggagggcagtaacttgggggctcccttgtcagcctacagacagtctcaggtttcgcaaccggccatgcagcaacaccccatgggccacaacggaacggtgactgccgcctaccatatgacagcggcaggggtcccccagctctcccacgctacgatggggggctactgcaatgggaacctgggcaacatgagcgagctcccgccttaccaggacaccatgcggaacagcgcttcggcgacaggatggtacggcaccaacccggacccccgcttctcctcaatctcccgcttcatggcgccgtcctcgggcatgaacatgggcggcatgggcggcctgagctccctgggggacgtgagcaagagcatggccccgctgcagagcacgccgcggaggaaacggagggtcctgttttcccaggcccaggtttacgagctggagagacgtttcaagcagcagaaatacctctccgcccccgagagggaacatttagccagcatgatccacctcaccccgactcaggtcaaaatctggttccagaaccaccgctacaagatgaagcggcaggccaaagacaaggctgcgcagcagcagatgcaacaggagaacggctcttgccagcagcagcagtcccccaggagggtggcggtgccggtgctggtgaaggatggcaagccctgccaggcgggctccaacacccccaccgcagccatccagagccacccgcagcaggcggccacgaccatcacggtggccaccaatggcaacagcctcggacagcatcagagccatcagacaaacagtgcggggcagtctcccgacatgggacagcactcggccagcccttcctccctgcagagccaagtctccagtttgtctcacctgaactcttccacttctgactatggcactgccatgtcctgctccaccttgctatacggtaggacctggtgaaaggattaaagaaagcgaaacgaaacaagacaaaacaaaaagagaaaaagaaaaaagcagattttcccagtcacacagatctctgtcctgtccgaagtgctgggtgctttcctttgctcttttattatttttctttcttttttcttttatttttttttccctaaagcggttttttttttctttttttcttcatttttttttcttcttcgttttactgactggttctctgaggacccccaagagagaaagggagagagtgactttttgttccgttcgctgatactgtgacggttttgggtcttgctttttttcccgtttccccccagcttgctgcgtggggtgttaaaccaattctgaccaataaccacggagcagtctgcagacaggggcccgtcggtaggcacggcccgaaggctcggattgcagatggaccctttgccagcgtctaggacttgcatgtaaatatagagattggggaggatggggttggggtttttcccaaaaacgtggtcgcggcacgcagccacagagcaacctcccccacccccccggctccgctcccagccccgtcccagcgatggagccgggggggccacacgaggctttggcttttctttacgtttgatgtgaacctgtagctgtataatgctgtcaaaagttggactaaacccatagtttttagtatcctgtatattttgttgtaaaaagaaagaaaaaaaaaatacaatcaaccaaaccaaccccacccccccttttttatggacaccgatcgtcccctcgtaaaccctccggcagtttgttctttgcgcacgccgccttttcctgttgtaacttatgtagatatttggcttaaatatagttcctaagaagcttctaataaattatacacattgcgaata

//