LOCUS       NM_001396031            1619 bp    mRNA    linear   VRT 24-SEP-2023
DEFINITION  Gallus gallus POU class 3 homeobox 1 (POU3F1), mRNA.
ACCESSION   NM_001396031
VERSION     NM_001396031.2
KEYWORDS    RefSeq.
SOURCE      Gallus gallus (chicken)
  ORGANISM  Gallus gallus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
            Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
            Phasianidae; Phasianinae; Gallus.
REFERENCE   1  (bases 1 to 1619)
  AUTHORS   Tang H, Finn RD and Thomas PD.
  TITLE     TreeGrafter: phylogenetic tree-based annotation of proteins with
            Gene Ontology terms and other annotations
  JOURNAL   Bioinformatics 35 (3), 518-520 (2019)
   PUBMED   30032202
REFERENCE   2  (bases 1 to 1619)
  AUTHORS   Burge S, Kelly E, Lonsdale D, Mutowo-Muellenet P, McAnulla C,
            Mitchell A, Sangrador-Vegas A, Yong SY, Mulder N and Hunter S.
  TITLE     Manual GO annotation of predictive protein signatures: the InterPro
            approach to GO curation
  JOURNAL   Database (Oxford) 2012, bar068 (2012)
   PUBMED   22301074
  REMARK    Publication Status: Online-Only
REFERENCE   3  (bases 1 to 1619)
  AUTHORS   Rowan S and Cepko CL.
  TITLE     A POU factor binding site upstream of the Chx10 homeobox gene is
            required for Chx10 expression in subsets of retinal progenitor
            cells and bipolar cells
  JOURNAL   Dev Biol 281 (2), 240-255 (2005)
   PUBMED   15893976
  REMARK    GeneRIF: These data identify Brn-2 as a new marker of subsets of
            RPCs and suggest a mechanism by which a combination of POU factors
            and Chx10 define RPC gene expression patterns, such as that of
            Nestin.
REFERENCE   4  (bases 1 to 1619)
  AUTHORS   Levavasseur F, Mandemakers W, Visser P, Broos L, Grosveld F,
            Zivkovic D and Meijer D.
  TITLE     Comparison of sequence and function of the Oct-6 genes in
            zebrafish, chicken and mouse
  JOURNAL   Mech Dev 74 (1-2), 89-98 (1998)
   PUBMED   9651490
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            JAENSK010000339.1.
            
            On Dec 13, 2021 this sequence version replaced NM_001396031.1.
            
            Sequence Note: The RefSeq transcript and protein were derived from
            genomic sequence to make the sequence consistent with the reference
            genome assembly. The genomic coordinates used for the transcript
            record were based on alignments.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-1619              JAENSK010000339.1  3495392-3497010
FEATURES             Location/Qualifiers
     source          1..1619
                     /organism="Gallus gallus"
                     /mol_type="mRNA"
                     /db_xref="taxon:9031"
                     /chromosome="23"
                     /map="23"
     gene            1..1619
                     /gene="POU3F1"
                     /gene_synonym="Oct-6"
                     /note="POU class 3 homeobox 1"
                     /db_xref="CGNC:53900"
                     /db_xref="GeneID:430270"
     exon            1..1619
                     /gene="POU3F1"
                     /gene_synonym="Oct-6"
                     /inference="alignment:Splign:2.1.0"
     CDS             9..1133
                     /gene="POU3F1"
                     /gene_synonym="Oct-6"
                     /note="POU class III transcription factor"
                     /codon_start=1
                     /product="POU domain, class 3, transcription factor 1"
                     /protein_id="NP_001382960.1"
                     /db_xref="CGNC:53900"
                     /db_xref="GeneID:430270"
                     /translation="

MAAAAQYLPRSAALLHPDGDRLHQGTTYREVQKMMHHEYLQGLAPAAAGHAVGLAHHQWLPSAGTDWGSGGGGGGGAHLPPAAEHGKGGPGGPREELPPAAAFHPRPHLVPQAGGWAQGAGPPPHLPPMSPPSGQPLLYGQPYGGLNGMLGPPGPALHHGHGLRDPLGAEEAAGHELAASPPPPLGPPEPSDEDAPSSDDLEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLNKWLEETDSSTGSPTNLDKIAAQGRKRKKRTSIEVGVKGALENHFLKCPKPSAHEITSLADSLQLEKEVVRVWFCNRRQKEKRMTPAGLPHPPMEDVYAQADTSPLHHALPGAVP"

     misc_feature    585..809
                     /gene="POU3F1"
                     /gene_synonym="Oct-6"
                     /note="Found in Pit-Oct-Unc transcription factors; Region:
                     POU; smart00352"
                     /db_xref="CDD:197673"
     misc_feature    864..1034
                     /gene="POU3F1"
                     /gene_synonym="Oct-6"
                     /note="Region: Homeodomain; pfam00046"
                     /db_xref="CDD:459649"
ORIGIN      

agacggccatggccgccgccgcgcagtacctcccgcgctccgccgcgctgctgcaccccgacggcgaccgcctgcatcagggcaccacgtaccgcgaggtgcagaagatgatgcaccacgagtacctgcagggcctggcccccgccgccgccgggcacgccgtcgggctggcgcaccaccagtggctgcccagcgccggcacggactggggcagcggcggaggaggaggaggcggcgcgcacctcccgccggcggccgagcacggcaagggcggcccgggagggccccgcgaggagctgccccccgccgccgctttccacccgcggccgcacttggtgccgcaggccggcggctgggcgcagggcgcggggccgccccctcacctgcccccgatgtcgccgccgtcggggcagccgctgctttacgggcagccctacggcggcctcaacgggatgctgggcccccccggccccgcgctgcaccacgggcacgggctgcgcgacccgctgggcgccgaggaggcggcgggccacgagctggcggcctccccgccgccgccgctggggccgcccgagccgtcggacgaggacgcgccgagctccgacgacctggagcagttcgccaagcagttcaagcagcggcggatcaagctgggcttcacgcaggccgacgtggggctcgcgctcggtaccctctacgggaacgtcttctcgcagaccaccatctgccgcttcgaggcgctgcagctgagcttcaagaacatgtgcaagctgaagccgttgctcaacaagtggctggaggagacggactccagcacgggcagccccaccaacctggacaagatcgcggcgcagggcaggaaacgcaagaagcgcacctccatcgaggtgggcgtcaagggcgccctggagaaccacttcctcaagtgccccaagccctcggcgcacgagatcacctccctggcggactccctgcagctggagaaggaggtggtgcgggtctggttctgcaaccggcggcagaaggagaagcgcatgacgccggccgggctccctcacccgcccatggaggacgtttacgcacaggcggacacttcgccgctgcaccacgcgctgcccggcgccgtgccgtgaccgccggccccgccgctgggccccgacggcggcggcggagcgggcgcgggcggcgggacgcgccccggttccttctttccttccttcctcggactggcccggcccggccgccctccccagccctatttattcgggcgccggagccgctcgcggccgcagcagaagtagccaaaggtttgcgatctctaatttattccctcccgcggggcccccggctccggcccggccgtaggacgcggcgctgcccgccccggcccctttctatttattttctaaccgtgcgcggagctctctccctcccgttggtaggttcggttcggttcacccccccaccctccctttcccctttggtttcggtttttgtttgttttggtttttttttttcgtttgtatctttattgcaaaaccaatgtagactgcgagggtacgtttctatttatgttatagtaaatattttattacttacataaaccatttacccaggaa

//