GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-11-01 12:41:15, GGRNA.v2 : RefSeq release 226 (Sep, 2024)

LOCUS       XM_021474553            1304 bp    mRNA    linear   VRT 15-JUN-2017
DEFINITION  PREDICTED: Danio rerio expressed sequence CO360592 (gb:co360592),
            transcript variant X5, mRNA.
ACCESSION   XM_021474553
VERSION     XM_021474553.1
DBLINK      BioProject: PRJNA13922
KEYWORDS    RefSeq.
SOURCE      Danio rerio (zebrafish)
  ORGANISM  Danio rerio
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Actinopterygii; Neopterygii; Teleostei; Ostariophysi;
            Cypriniformes; Danionidae; Danioninae; Danio.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_018395365.1) annotated using gene prediction method: Gnomon,
            supported by mRNA evidence.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Version          :: Danio rerio Annotation Release 106
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 7.4
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1304
                     /organism="Danio rerio"
                     /mol_type="mRNA"
                     /strain="Tuebingen"
                     /db_xref="taxon:7955"
                     /chromosome="24"
                     /map="unlocalized"
     gene            1..1304
                     /gene="gb:co360592"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 1 mRNA, and 72% coverage of the
                     annotated genomic feature by RNAseq alignments"
                     /db_xref="GeneID:558891"
                     /db_xref="ZFIN:ZDB-GENE-071015-3"
     CDS             725..1249
                     /gene="gb:co360592"
                     /codon_start=1
                     /product="uncharacterized protein C11orf65 homolog isoform
                     X1"
                     /protein_id="XP_021330228.1"
                     /db_xref="GeneID:558891"
                     /db_xref="ZFIN:ZDB-GENE-071015-3"
                     /translation="
MPYCTELQPCDWLIRNLHERAVGQVYLIKWPFSTSEDPIFKLTEDTKKTEFHHCKIRRQQDVARKKKMRKIEWMRKMYAEGRTGHSKTAQQLQNSPETLLDSFETSDFEQEVDELLAWTRALDFDDYINEWRNLGTSRCYIVDKDELSVDVQRDFGICKISPLRQDESQHLDLI"
     misc_feature    <818..1135
                     /gene="gb:co360592"
                     /note="chromosome 11 open reading frame 65 and homologs;
                     Region: C11orf65; cd21090"
                     /db_xref="CDD:411042"
ORIGIN      
gtttgtggaaatgtagttgaaacgattttgtttgtttttcgatattcagcgcatgggattgatctgaaatgtatgtttacatctaacgttaagggctttatttacaccgcctcagatttaattacatattttattcccctaacgttactgcctaaatctttcattcggctatattttctataagcctgaatctgtttgttgattatgtgaagacgtctccagagatcaacacgtgctagcatgagcaagaaaatgactgaacacgaatactccattgacaggcatcaccccgcatctccagctgaggaaaccacatcacagactaatgtcattcttgtcccacagctggaagcagagttcagccgagcagccatgatcatccagagagcttggagaaaacatgttgatactgctgttttcaagcacctcaagaagcttctgagcttccataatcaaggggatccacgtctcctccttagatttattaaccctgctgaggctaatattctggatgctgcttcaggggctcttatcagattccgattgggtgggtccccttattaaaccaaggttgtcacagcggaatgaaccaccaacttatccaacacatgtcttacgcagcggatgcccttccagctgcaaaccatcactgggaaaatgccccattaaatcaccattctgatgctcggtttgaactgcagcagatcgtcttgaccatgtctacatgccttactgcactgagttgcagccatgtgattggctgattagaaatttgcatgaacgagcagttggacaggtgtacctaataaagtggccattttccacgtctgaagacccaatcttcaaactaactgaagataccaagaagacagaattccatcactgcaaaatccgccggcagcaagatgttgctagaaaaaagaagatgcggaaaattgaatggatgaggaaaatgtatgcggaaggccgtacaggacacagtaaaacagcacaacagcttcagaattccccagagacattgttagattcatttgaaacttccgactttgagcaggaagtggatgagctgctagcgtggaccagagctcttgattttgatgactatattaatgaatggaggaatttgggcaccagcagatgttacatagttgacaaagatgagctttctgtggatgttcagcgagactttggtatatgtaagatttctccgctcagacaggatgagagtcaacatctggatctcatctgagagtttttactcatttgatttattaatttgaataaattaaaaagttctgaatcat
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]