2024-11-01 12:29:12, GGRNA.v2 : RefSeq release 226 (Sep, 2024)
LOCUS XM_021472265 651 bp mRNA linear VRT 15-JUN-2017 DEFINITION PREDICTED: Danio rerio C-type lectin domain family 4 member F-like (LOC110437865), mRNA. ACCESSION XM_021472265 VERSION XM_021472265.1 DBLINK BioProject: PRJNA13922 KEYWORDS RefSeq; includes ab initio. SOURCE Danio rerio (zebrafish) ORGANISM Danio rerio Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes; Danionidae; Danioninae; Danio. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_018394784.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Version :: Danio rerio Annotation Release 106 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 7.4 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 100% of CDS bases ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..651 /organism="Danio rerio" /mol_type="mRNA" /strain="Tuebingen" /db_xref="taxon:7955" /chromosome="10" /map="unlocalized" gene 1..651 /gene="LOC110437865" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:110437865" CDS 1..651 /gene="LOC110437865" /codon_start=1 /product="C-type lectin domain family 4 member F-like" /protein_id="XP_021327940.1" /db_xref="GeneID:110437865" /translation="
MSQPIYASINTNSRLKMDRSSHRNQTVIVLSVFIYTNNKNCAKDRRQLVTNISNLTGAKDELTNLLMERDQLIKQLQIFGQEAVWFYYQSSFYYLSNETKSWTESRRCCKDRGADLIIVNNKQEQDFIMKITGNNEFWIGLTDSDEEGNWKWVDGSILTSGFWASSGSITEPNGRETENCAVTHLKKHPELKGWLDVACDDAHQWICEKSILPVTI"
misc_feature 253..627 /gene="LOC110437865" /note="C-type lectin-like domain (CTLD) of the type found in human dendritic cell (DC)-specific intercellular adhesion molecule 3-grabbing non-integrin (DC-SIGN) and the related receptor, DC-SIGN receptor (DC-SIGNR); Region: CLECT_DC-SIGN_like; cd03590" /db_xref="CDD:153060" misc_feature order(406..408,511..513,517..519,532..534,562..567, 583..594) /gene="LOC110437865" /note="carbohydrate binding site; other site" /db_xref="CDD:153060" misc_feature order(427..429,439..441,532..537) /gene="LOC110437865" /note="calcium binding site 1 [ion binding]; other site" /db_xref="CDD:153060" misc_feature order(439..441,535..537) /gene="LOC110437865" /note="calcium binding site 3 [ion binding]; other site" /db_xref="CDD:153060" ORIGIN
atgtctcagcctatttatgccagcataaacacaaattcaagactgaagatggacaggtcctctcatagaaatcaaacagtcatagtgctgagtgtcttcatctatacaaacaacaaaaactgtgctaaagataggcgccagctagtaaccaacatcagcaacctcacaggagccaaagatgagctaacaaaccttctgatggaaagagaccaactaataaagcaacttcagatttttggtcaagaagctgtatggttttactatcaatccagtttttactacttgtccaatgaaacaaagagctggactgagagcagaagatgctgtaaagacagaggagcagatctgatcatcgtaaacaacaaacaggaacaagattttattatgaagatcactggtaacaatgaattctggattggtctgactgacagtgatgaagaaggaaattggaaatgggttgatggcagtatactgacctctgggttctgggcttcctctggatcaataactgagcccaatggacgagaaacagagaactgtgctgtgacccatttaaaaaagcaccctgagttaaagggatggcttgatgttgcatgtgatgatgctcatcaatggatctgtgagaagtccattttaccagttaccatttaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]