2024-11-01 12:37:45, GGRNA.v2 : RefSeq release 226 (Sep, 2024)
LOCUS XM_005172495 719 bp mRNA linear VRT 08-SEP-2024 DEFINITION PREDICTED: Danio rerio ring finger protein 122 (rnf122), transcript variant X1, mRNA. ACCESSION XM_005172495 VERSION XM_005172495.5 DBLINK BioProject: PRJNA13922 KEYWORDS RefSeq. SOURCE Danio rerio (zebrafish) ORGANISM Danio rerio Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes; Danionidae; Danioninae; Danio. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_007119.7) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 8, 2024 this sequence version replaced XM_005172495.4. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_000002035.6-RS_2024_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/15/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..719 /organism="Danio rerio" /mol_type="mRNA" /strain="Tuebingen" /db_xref="taxon:7955" /chromosome="8" gene 1..719 /gene="rnf122" /gene_synonym="si:ch1073-392o20.1" /note="ring finger protein 122; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 100% coverage of the annotated genomic feature by RNAseq alignments, including 103 samples with support for all annotated introns" /db_xref="GeneID:100329730" /db_xref="ZFIN:ZDB-GENE-091204-454" CDS 127..591 /gene="rnf122" /gene_synonym="si:ch1073-392o20.1" /codon_start=1 /product="RING finger protein 122 isoform X1" /protein_id="XP_005172552.1" /db_xref="GeneID:100329730" /db_xref="ZFIN:ZDB-GENE-091204-454" /translation="
MHPFQWCNGCFCGLGLIYSNKTCTMPSVTFQDLPLNIYMVIFGTGIFVFVLSLIFCCYFISKLRHQAQSERFGYREVVLKGDPKKLNLHGTCAVCLEDFKVKDELGVLPCQHAFHRRCVVKWLEVRCVCPMCNKPLSGSSEQHQSLGTLLDELV"
misc_feature 397..534 /gene="rnf122" /gene_synonym="si:ch1073-392o20.1" /note="RING finger (Really Interesting New Gene) domain and U-box domain superfamily; Region: RING_Ubox; cl17238" /db_xref="CDD:473075" misc_feature order(400..402,409..411,454..456,460..462,469..471, 478..480,511..513,520..522) /gene="rnf122" /gene_synonym="si:ch1073-392o20.1" /note="cross-brace motif; other site" /db_xref="CDD:438111" ORIGIN
gtgattgtgttttgggtgaatccagatgtgatgtatggcctgacagagagacagacaggcggagggcatcgtctctgtttataaacacacggatcttcatataggaatcagatatatgggggattaatgcaccctttccagtggtgcaacgggtgcttctgcggtttgggactaatctactccaataagacctgcactatgccctccgtcaccttccaggaccttcctctcaacatctacatggtcatcttcggcacaggcatcttcgtcttcgtcctcagcctcatcttctgctgctacttcataagtaaattgagacatcaggctcaaagtgaacgctttggataccgagaggtggttttaaaaggggatccaaagaagctgaatctacatgggacgtgtgcagtgtgtctggaggactttaaggtgaaagatgagctgggagtgttgccatgccaacatgcctttcacaggaggtgtgtggtgaagtggctggaggtgcgctgtgtgtgtccaatgtgtaacaaacctctgtctggatcctccgagcagcaccagagcctcgggactctgctggatgagctggtgtagagcgcagactagcattagcatcaaaaaaaacaaaaaaactcacaaacgcctctgacctgactgtgatttcacccgaatctgagactgatgaacgccagggccacgtcttattcatgacgaaccaactg
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]