2024-11-01 10:10:22, GGRNA.v2 : RefSeq release 226 (Sep, 2024)
LOCUS XM_005160713 1508 bp mRNA linear VRT 15-JUN-2017 DEFINITION PREDICTED: Danio rerio LIM homeobox transcription factor 1, alpha (lmx1a), transcript variant X2, mRNA. ACCESSION XM_005160713 VERSION XM_005160713.3 DBLINK BioProject: PRJNA13922 KEYWORDS RefSeq. SOURCE Danio rerio (zebrafish) ORGANISM Danio rerio Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes; Danionidae; Danioninae; Danio. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_007131.7) annotated using gene prediction method: Gnomon, supported by EST evidence. Also see: Documentation of NCBI's Annotation Process On Jun 15, 2017 this sequence version replaced XM_005160713.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Version :: Danio rerio Annotation Release 106 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 7.4 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1508 /organism="Danio rerio" /mol_type="mRNA" /strain="Tuebingen" /db_xref="taxon:7955" /chromosome="20" gene 1..1508 /gene="lmx1a" /gene_synonym="si:ch211-260g14.3" /note="LIM homeobox transcription factor 1, alpha; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 4 ESTs, 2 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 1 sample with support for all annotated introns" /db_xref="GeneID:558036" /db_xref="ZFIN:ZDB-GENE-041014-332" CDS 425..1231 /gene="lmx1a" /gene_synonym="si:ch211-260g14.3" /codon_start=1 /product="LIM homeobox transcription factor 1, alpha isoform X2" /protein_id="XP_005160770.1" /db_xref="GeneID:558036" /db_xref="ZFIN:ZDB-GENE-041014-332" /translation="
MRAQGSAVFHLRCFCCCVCGCRLQKGDHCVLRGDGLFCATHFHNQLASPTSSDSGKSEDIEEDNDDEDNLKTAGESNITGDVEHKRPKRPRTILTTQQRRAFKASFEVSSKPCRKVRETLAAETGLSVRVVQVWFQNQRAKMKKLVRRQQQQKQTVCPQEKRESPSQQHTATSCGALPVELECAGSYPLPQQNLSLDSQSLKLDPFRQGLTPPQMPGDHMHPYGCDTLYDETDSDPLCHFGDCMSSSELSFLTPIDRLYSMQDSYFAS"
misc_feature 686..856 /gene="lmx1a" /gene_synonym="si:ch211-260g14.3" /note="Region: Homeodomain; pfam00046" /db_xref="CDD:459649" ORIGIN
tcggcctcgtcttagtgttgtgttttgtgtattgggagactttggcacggaagtcctgaaaaaagacaaggtgactgcaggaggaagggtcgcggtgggccgtggaatgcgaggcggctttcacacacacaaacacacacacggttagatcaggaggacagcactactgacacgctgtcaagatgtgttaaattagcaggacccatcggcgtggcaacggcaagctggggacagcatatggccacatcgacacgatgctcggaccccctcggctaccccaaaactcagtctgattcacattctcacctccaaatgcgaaaaagtctgccaaacgaccgagcgtgatcgacgttagtaaaggtaaaggctgtttgtggtgcggtgtcagggctgctcagagatcatctctccgtctgagctggtgatgcgcgcacagggctctgctgtttttcacctgcgctgcttctgctgctgtgtgtgcggctgccggctgcagaagggagatcactgtgtgctccgaggagacggcctcttctgtgccacacacttccacaaccaactggccagtcccacctcctctgactcaggtaaaagtgaggatattgaggaggacaacgatgatgaagacaacttgaagactgcaggagagtcaaacataacaggagacgtggaacacaagaggcctaaaagacctcgtaccatcctgacaacacaacagagacgggctttcaaagcttcttttgaggtttcatccaaaccctgccgaaaggtgagggagactctggcagcagagacaggactgagcgtacgagtcgttcaggtctggttccagaaccaaagagccaagatgaaaaaactggtgagaagacaacagcagcagaagcaaactgtgtgcccacaggagaagagggagagtccatcacaacaacatactgcgacctcttgtggagctctgcctgttgagctggaatgtgcaggttcatatccacttccccagcagaatctcagtctagactcacagagcttgaagctggaccccttcagacagggcctgacccctcctcagatgcccggagaccacatgcatccctatggttgtgatacactctatgatgaaacagacagtgaccctctgtgtcattttggagactgtatgtcgtccagtgaactttcctttttaacacccattgaccgattgtattcaatgcaagattcgtatttcgcctcttgagcatcattctgacggctcattaaagatttatgaaggagcgtgtgtgtgtgtgtgtgtgtgtgtgtgtgtgtgtgtgtgtgtgtgtgtgtgtgtgtgtgtgtgggtgaatgtatacgcgtgcttgtatatgttctgcttatgcatgttttagtgtagaaatggttgtgattggcgacaaaggaaatgtaccgtgataaatattatttgtttaatttgtatttattatttttatgtgtgtaatcttgactgaattacaataaaatgctcatgacgtgtt
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]