GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-11-01 10:10:22, GGRNA.v2 : RefSeq release 226 (Sep, 2024)

LOCUS       XM_005160713            1508 bp    mRNA    linear   VRT 15-JUN-2017
DEFINITION  PREDICTED: Danio rerio LIM homeobox transcription factor 1, alpha
            (lmx1a), transcript variant X2, mRNA.
ACCESSION   XM_005160713
VERSION     XM_005160713.3
DBLINK      BioProject: PRJNA13922
KEYWORDS    RefSeq.
SOURCE      Danio rerio (zebrafish)
  ORGANISM  Danio rerio
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Actinopterygii; Neopterygii; Teleostei; Ostariophysi;
            Cypriniformes; Danionidae; Danioninae; Danio.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_007131.7) annotated using gene prediction method: Gnomon,
            supported by EST evidence.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Jun 15, 2017 this sequence version replaced XM_005160713.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Version          :: Danio rerio Annotation Release 106
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 7.4
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1508
                     /organism="Danio rerio"
                     /mol_type="mRNA"
                     /strain="Tuebingen"
                     /db_xref="taxon:7955"
                     /chromosome="20"
     gene            1..1508
                     /gene="lmx1a"
                     /gene_synonym="si:ch211-260g14.3"
                     /note="LIM homeobox transcription factor 1, alpha; Derived
                     by automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 4 ESTs, 2 Proteins, and 100% coverage of the annotated
                     genomic feature by RNAseq alignments, including 1 sample
                     with support for all annotated introns"
                     /db_xref="GeneID:558036"
                     /db_xref="ZFIN:ZDB-GENE-041014-332"
     CDS             425..1231
                     /gene="lmx1a"
                     /gene_synonym="si:ch211-260g14.3"
                     /codon_start=1
                     /product="LIM homeobox transcription factor 1, alpha
                     isoform X2"
                     /protein_id="XP_005160770.1"
                     /db_xref="GeneID:558036"
                     /db_xref="ZFIN:ZDB-GENE-041014-332"
                     /translation="
MRAQGSAVFHLRCFCCCVCGCRLQKGDHCVLRGDGLFCATHFHNQLASPTSSDSGKSEDIEEDNDDEDNLKTAGESNITGDVEHKRPKRPRTILTTQQRRAFKASFEVSSKPCRKVRETLAAETGLSVRVVQVWFQNQRAKMKKLVRRQQQQKQTVCPQEKRESPSQQHTATSCGALPVELECAGSYPLPQQNLSLDSQSLKLDPFRQGLTPPQMPGDHMHPYGCDTLYDETDSDPLCHFGDCMSSSELSFLTPIDRLYSMQDSYFAS"
     misc_feature    686..856
                     /gene="lmx1a"
                     /gene_synonym="si:ch211-260g14.3"
                     /note="Region: Homeodomain; pfam00046"
                     /db_xref="CDD:459649"
ORIGIN      
tcggcctcgtcttagtgttgtgttttgtgtattgggagactttggcacggaagtcctgaaaaaagacaaggtgactgcaggaggaagggtcgcggtgggccgtggaatgcgaggcggctttcacacacacaaacacacacacggttagatcaggaggacagcactactgacacgctgtcaagatgtgttaaattagcaggacccatcggcgtggcaacggcaagctggggacagcatatggccacatcgacacgatgctcggaccccctcggctaccccaaaactcagtctgattcacattctcacctccaaatgcgaaaaagtctgccaaacgaccgagcgtgatcgacgttagtaaaggtaaaggctgtttgtggtgcggtgtcagggctgctcagagatcatctctccgtctgagctggtgatgcgcgcacagggctctgctgtttttcacctgcgctgcttctgctgctgtgtgtgcggctgccggctgcagaagggagatcactgtgtgctccgaggagacggcctcttctgtgccacacacttccacaaccaactggccagtcccacctcctctgactcaggtaaaagtgaggatattgaggaggacaacgatgatgaagacaacttgaagactgcaggagagtcaaacataacaggagacgtggaacacaagaggcctaaaagacctcgtaccatcctgacaacacaacagagacgggctttcaaagcttcttttgaggtttcatccaaaccctgccgaaaggtgagggagactctggcagcagagacaggactgagcgtacgagtcgttcaggtctggttccagaaccaaagagccaagatgaaaaaactggtgagaagacaacagcagcagaagcaaactgtgtgcccacaggagaagagggagagtccatcacaacaacatactgcgacctcttgtggagctctgcctgttgagctggaatgtgcaggttcatatccacttccccagcagaatctcagtctagactcacagagcttgaagctggaccccttcagacagggcctgacccctcctcagatgcccggagaccacatgcatccctatggttgtgatacactctatgatgaaacagacagtgaccctctgtgtcattttggagactgtatgtcgtccagtgaactttcctttttaacacccattgaccgattgtattcaatgcaagattcgtatttcgcctcttgagcatcattctgacggctcattaaagatttatgaaggagcgtgtgtgtgtgtgtgtgtgtgtgtgtgtgtgtgtgtgtgtgtgtgtgtgtgtgtgtgtgtgtgggtgaatgtatacgcgtgcttgtatatgttctgcttatgcatgttttagtgtagaaatggttgtgattggcgacaaaggaaatgtaccgtgataaatattatttgtttaatttgtatttattatttttatgtgtgtaatcttgactgaattacaataaaatgctcatgacgtgtt
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]