2024-11-01 12:30:24, GGRNA.v2 : RefSeq release 226 (Sep, 2024)
LOCUS NM_199980 1823 bp mRNA linear VRT 30-APR-2023 DEFINITION Danio rerio integral membrane protein 2Cb (itm2cb), mRNA. ACCESSION NM_199980 VERSION NM_199980.1 KEYWORDS RefSeq. SOURCE Danio rerio (zebrafish) ORGANISM Danio rerio Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes; Danionidae; Danioninae; Danio. REFERENCE 1 (bases 1 to 1823) AUTHORS Hu B, Lelek S, Spanjaard B, El-Sammak H, Simoes MG, Mintcheva J, Aliee H, Schafer R, Meyer AM, Theis F, Stainier DYR, Panakova D and Junker JP. TITLE Origin and function of activated fibroblast states during zebrafish heart regeneration JOURNAL Nat Genet 54 (8), 1227-1237 (2022) PUBMED 35864193 REFERENCE 2 (bases 1 to 1823) AUTHORS Horzmann KA, Lin LF, Taslakjian B, Yuan C and Freeman JL. TITLE Embryonic atrazine exposure and later in life behavioral and brain transcriptomic, epigenetic, and pathological alterations in adult male zebrafish JOURNAL Cell Biol Toxicol 37 (3), 421-439 (2021) PUBMED 32737625 REFERENCE 3 (bases 1 to 1823) AUTHORS Meyer DN, Crofts EJ, Akemann C, Gurdziel K, Farr R, Baker BB, Weber D and Baker TR. TITLE Developmental exposure to Pb2+ induces transgenerational changes to zebrafish brain transcriptome JOURNAL Chemosphere 244, 125527 (2020) PUBMED 31816550 REFERENCE 4 (bases 1 to 1823) AUTHORS Elkon R, Milon B, Morrison L, Shah M, Vijayakumar S, Racherla M, Leitch CC, Silipino L, Hadi S, Weiss-Gayet M, Barras E, Schmid CD, Ait-Lounis A, Barnes A, Song Y, Eisenman DJ, Eliyahu E, Frolenkov GI, Strome SE, Durand B, Zaghloul NA, Jones SM, Reith W and Hertzano R. TITLE RFX transcription factors are essential for hearing in mice JOURNAL Nat Commun 6, 8549 (2015) PUBMED 26469318 REMARK Publication Status: Online-Only REFERENCE 5 (bases 1 to 1823) AUTHORS Crespo B, Lan-Chow-Wing O, Rocha A, Zanuy S and Gomez A. TITLE foxl2 and foxl3 are two ancient paralogs that remain fully functional in teleosts JOURNAL Gen Comp Endocrinol 194, 81-93 (2013) PUBMED 24045113 REFERENCE 6 (bases 1 to 1823) AUTHORS Garnett AT, Han TM, Gilchrist MJ, Smith JC, Eisen MB, Wardle FC and Amacher SL. TITLE Identification of direct T-box target genes in the developing zebrafish mesoderm JOURNAL Development 136 (5), 749-760 (2009) PUBMED 19158186 REFERENCE 7 (bases 1 to 1823) AUTHORS McPartland JM, Glass M, Matias I, Norris RW and Kilpatrick CW. TITLE A shifted repertoire of endocannabinoid genes in the zebrafish (Danio rerio) JOURNAL Mol Genet Genomics 277 (5), 555-570 (2007) PUBMED 17256142 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from BC054689.1. ##Evidence-Data-START## Transcript exon combination :: BC054689.1, EH496870.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMEA4476797 [ECO:0000348] ##Evidence-Data-END## FEATURES Location/Qualifiers source 1..1823 /organism="Danio rerio" /mol_type="mRNA" /db_xref="taxon:7955" /chromosome="2" /map="2" gene 1..1823 /gene="itm2cb" /gene_synonym="fj35c02; itm2c; wu:fj35c02; zgc:66349" /note="integral membrane protein 2Cb" /db_xref="GeneID:335863" /db_xref="ZFIN:ZDB-GENE-030131-7806" exon 1..170 /gene="itm2cb" /gene_synonym="fj35c02; itm2c; wu:fj35c02; zgc:66349" /inference="alignment:Splign:2.1.0" CDS 78..860 /gene="itm2cb" /gene_synonym="fj35c02; itm2c; wu:fj35c02; zgc:66349" /note="integral membrane protein 2C" /codon_start=1 /product="integral membrane protein 2Cb" /protein_id="NP_956274.1" /db_xref="GeneID:335863" /db_xref="ZFIN:ZDB-GENE-030131-7806" /translation="
MVKISFQQVTVQKPEKENDGDKEEIQMPYSHKDELVLPVRSKKSPFSGLWCVVLGLVIFLSGLIMASVCLYRYYFNPQIPEDSFFHCRMMYEDPVFAPLLGRQELEEKVGIYLDDNYEQISVPVPDFGSGDPADIIHDFHRGLTAYYDIALDKCYVIELNTTIVMPPRNLWELLVNVKRGTYLPQTYMIQEEMVVTGRVRNLRQLGPFIHRLCYAKETYRLRRRSGQRRIDKRETKNCHTIRHFENTFAVETKICERLLL"
misc_feature 456..734 /gene="itm2cb" /gene_synonym="fj35c02; itm2c; wu:fj35c02; zgc:66349" /note="The BRICHOS domain is found in a variety of proteins implicated in dementia, respiratory distress and cancer; Region: BRICHOS; smart01039" /db_xref="CDD:198107" exon 171..311 /gene="itm2cb" /gene_synonym="fj35c02; itm2c; wu:fj35c02; zgc:66349" /inference="alignment:Splign:2.1.0" exon 312..500 /gene="itm2cb" /gene_synonym="fj35c02; itm2c; wu:fj35c02; zgc:66349" /inference="alignment:Splign:2.1.0" exon 501..611 /gene="itm2cb" /gene_synonym="fj35c02; itm2c; wu:fj35c02; zgc:66349" /inference="alignment:Splign:2.1.0" exon 612..762 /gene="itm2cb" /gene_synonym="fj35c02; itm2c; wu:fj35c02; zgc:66349" /inference="alignment:Splign:2.1.0" exon 763..1804 /gene="itm2cb" /gene_synonym="fj35c02; itm2c; wu:fj35c02; zgc:66349" /inference="alignment:Splign:2.1.0" ORIGIN
cacagctcagaagcgtccttggtggtacaatcaacactggacgtcctgaccgcagcagactagcaggagtcgacaaaatggtgaagatttccttccagcaagtgactgtgcagaagccagaaaaggagaacgatggagacaaagaggaaatccaaatgccgtactctcacaaggatgagttggtgctcccggtgagatctaagaagtctcccttcagtggcctttggtgtgtggtgctcggcctggtgatcttcctgtcaggcttgatcatggcctcagtgtgcctctacagatattacttcaaccctcagattccagaggacagtttcttccactgtcggatgatgtatgaagaccctgtgttcgcccctttactcggccgacaggagttagaagagaaagtgggcatctacctggacgataactatgagcagatcagcgttcccgtgccagatttcggtagcggcgacccggcagacatcattcatgactttcacaggggactcacagcttactacgacattgcgttggataagtgctacgtgatcgagctcaacaccacaattgtcatgccgcccagaaacctgtgggaactgcttgtcaatgtcaagcggggaacgtatttgccccagacctacatgattcaggaggagatggtggtaactggacgcgtcaggaacttgcgtcagctaggacccttcatccaccggctctgctacgcaaaagagacctacagactgcgacgccgtagcggacaaagacgcatcgataagagggagacgaaaaactgccacaccatccggcacttcgagaacacatttgctgtggagacgaagatctgtgaacgactcctgctgtagtttccctctcctatctcctccaatctactgagcaaaacccaaaccatctgtccagcttaacagcactttatcagcttgataaacctgtaaatgatgttagataaagccatgtctgttctctgtttgtcttttttttctaatgataaactgttacttttttcattatatatatatttttgtctttgttagtttttgatttgcactttgtctgtagtataacgttttatttcactctcaggttatgtgtgtgttgttgtttttcttcttgtggggaaagaagttgagattagcttcagacatttttagtctggcaatcgctgatgaatgatttgcattatttctgtttgtttgtttttgtgtcaagcctcggtttgtgtagactgacggctggttaagtggtttctttatctgtttgtttcctcttgtgttagcaaagaaatccagtattagaaaatcatcttcaatgccaaaagatgtatacctcatattttagaaatgacttcaagtcatagcgtaggtttgaacgtgatctaagcaatatacgttttcttatcttggatttcctatcttgaatttcatcggtttgtcgtcttgtttgtcaactgatgctccaagcattgctctttaatacttgtgaataaagtttgtagaaaaattttaaaaactgaaatggttccttatctttaaatgcagtgtgtgtgtgtgcgcatactgatcagaatggctgatttgaattgtcttttggcacagatgtgcgtaaatgtagtcctttctcttttttttatgttcatgcccaaggcagatccactagattcacttcatattgcttgcacttttttttctagtcgtaccatttatgtgtgtttgttcctcttccacataatggtgtagcaaagaactggttttgtctgaaataaatgaggcgtttaatttgatgcactctaaaaaaaaaaaaaaaaaaaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]