GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-11-01 14:37:41, GGRNA.v2 : RefSeq release 226 (Sep, 2024)

LOCUS       NM_180964                755 bp    mRNA    linear   VRT 02-APR-2024
DEFINITION  Danio rerio claudin d (cldnd), mRNA.
ACCESSION   NM_180964
VERSION     NM_180964.2
KEYWORDS    RefSeq.
SOURCE      Danio rerio (zebrafish)
  ORGANISM  Danio rerio
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Actinopterygii; Neopterygii; Teleostei; Ostariophysi;
            Cypriniformes; Danionidae; Danioninae; Danio.
REFERENCE   1  (bases 1 to 755)
  AUTHORS   Rostam,N., Goloborodko,A., Riemer,S., Hertel,A., Riedel,D.,
            Vorbruggen,G. and Dosch,R.
  TITLE     The germ plasm is anchored at the cleavage furrows through
            interaction with tight junctions in the early zebrafish embryo
  JOURNAL   Development 149 (15) (2022)
   PUBMED   35735123
REFERENCE   2  (bases 1 to 755)
  AUTHORS   Solis,C.J., Hamilton,M.K., Caruffo,M., Garcia-Lopez,J.P.,
            Navarrete,P., Guillemin,K. and Feijoo,C.G.
  TITLE     Intestinal Inflammation Induced by Soybean Meal Ingestion Increases
            Intestinal Permeability and Neutrophil Turnover Independently of
            Microbiota in Zebrafish
  JOURNAL   Front Immunol 11, 1330 (2020)
   PUBMED   32793187
  REMARK    Publication Status: Online-Only
REFERENCE   3  (bases 1 to 755)
  AUTHORS   Schwayer,C., Shamipour,S., Pranjic-Ferscha,K., Schauer,A.,
            Balda,M., Tada,M., Matter,K. and Heisenberg,C.P.
  TITLE     Mechanosensation of Tight Junctions Depends on ZO-1 Phase
            Separation and Flow
  JOURNAL   Cell 179 (4), 937-952 (2019)
   PUBMED   31675500
REFERENCE   4  (bases 1 to 755)
  AUTHORS   Hou,J., Liu,H., Zhang,S., Liu,X., Hayat,T., Alsaedi,A. and Wang,X.
  TITLE     Mechanism of toxic effects of Nano-ZnO on cell cycle of zebrafish
            (Danio rerio)
  JOURNAL   Chemosphere 229, 206-213 (2019)
   PUBMED   31078877
REFERENCE   5  (bases 1 to 755)
  AUTHORS   Sun,J., Yan,L., Shen,W. and Meng,A.
  TITLE     Maternal Ybx1 safeguards zebrafish oocyte maturation and
            maternal-to-zygotic transition by repressing global translation
  JOURNAL   Development 145 (19) (2018)
   PUBMED   30135188
  REMARK    Publication Status: Online-Only
REFERENCE   6  (bases 1 to 755)
  AUTHORS   Clelland,E.S. and Kelly,S.P.
  TITLE     Exogenous GDF9 but not Activin A, BMP15 or TGFbeta alters tight
            junction protein transcript abundance in zebrafish ovarian
            follicles
  JOURNAL   Gen Comp Endocrinol 171 (2), 211-217 (2011)
   PUBMED   21291886
REFERENCE   7  (bases 1 to 755)
  AUTHORS   Clelland,E.S. and Kelly,S.P.
  TITLE     Tight junction proteins in zebrafish ovarian follicles: stage
            specific mRNA abundance and response to 17beta-estradiol, human
            chorionic gonadotropin, and maturation inducing hormone
  JOURNAL   Gen Comp Endocrinol 168 (3), 388-400 (2010)
   PUBMED   20553723
REFERENCE   8  (bases 1 to 755)
  AUTHORS   Loh,Y.H., Christoffels,A., Brenner,S., Hunziker,W. and Venkatesh,B.
  TITLE     Extensive expansion of the claudin gene family in the teleost fish,
            Fugu rubripes
  JOURNAL   Genome Res 14 (7), 1248-1257 (2004)
   PUBMED   15197168
REFERENCE   9  (bases 1 to 755)
  AUTHORS   Li,Y., Chia,J.M., Bartfai,R., Christoffels,A., Yue,G.H., Ding,K.,
            Ho,M.Y., Hill,J.A., Stupka,E. and Orban,L.
  TITLE     Comparative analysis of the testis and ovary transcriptomes in
            zebrafish by combining experimental and computational tools
  JOURNAL   Comp Funct Genomics 5 (5), 403-418 (2004)
   PUBMED   18629171
REFERENCE   10 (bases 1 to 755)
  AUTHORS   Gong,Z., Yan,T., Liao,J., Lee,S.E., He,J. and Hew,C.L.
  TITLE     Rapid identification and isolation of zebrafish cDNA clones
  JOURNAL   Gene 201 (1-2), 87-98 (1997)
   PUBMED   9409775
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from AJ011789.1.
            
            On Jun 3, 2003 this sequence version replaced NM_180964.1.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: AJ011789.1 [ECO:0000332]
            ##Evidence-Data-END##
FEATURES             Location/Qualifiers
     source          1..755
                     /organism="Danio rerio"
                     /mol_type="mRNA"
                     /db_xref="taxon:7955"
                     /chromosome="21"
                     /map="21"
     gene            1..755
                     /gene="cldnd"
                     /gene_synonym="cldn29a; ns:zf-a310; zf-a310; zgc:101004"
                     /note="claudin d"
                     /db_xref="GeneID:81583"
                     /db_xref="ZFIN:ZDB-GENE-010328-4"
     exon            1..755
                     /gene="cldnd"
                     /gene_synonym="cldn29a; ns:zf-a310; zf-a310; zgc:101004"
                     /inference="alignment:Splign:2.1.0"
     CDS             11..637
                     /gene="cldnd"
                     /gene_synonym="cldn29a; ns:zf-a310; zf-a310; zgc:101004"
                     /codon_start=1
                     /product="claudin-like protein ZF-A89"
                     /protein_id="NP_851295.1"
                     /db_xref="GeneID:81583"
                     /db_xref="ZFIN:ZDB-GENE-010328-4"
                     /translation="
MASVGLQLLATVLAIIGWLGEIVICALPMWKVTAFIGNNIVTAQIFWEGLWMNCVQQSTGQMQCKVYDSMLALPQDLQAARALVVISIIVTFMGVFLTIAGGKCTNCIEDQDAKAKVVVAAGVFFLVGGILCLIPVCWSANSVIKDFYNPTLSDAQKRELGASLFIGWCASGLLLLGGALLCCQCPKNEGRAYSVKYSAPRSAPGAYV"
     misc_feature    23..520
                     /gene="cldnd"
                     /gene_synonym="cldn29a; ns:zf-a310; zf-a310; zgc:101004"
                     /note="PMP-22/EMP/MP20/Claudin family; Region:
                     PMP22_Claudin; cl21598"
                     /db_xref="CDD:473919"
     misc_feature    32..94
                     /gene="cldnd"
                     /gene_synonym="cldn29a; ns:zf-a310; zf-a310; zgc:101004"
                     /note="propagated from UniProtKB/Swiss-Prot (Q9YH91.1);
                     transmembrane region"
     misc_feature    254..316
                     /gene="cldnd"
                     /gene_synonym="cldn29a; ns:zf-a310; zf-a310; zgc:101004"
                     /note="propagated from UniProtKB/Swiss-Prot (Q9YH91.1);
                     transmembrane region"
     misc_feature    359..421
                     /gene="cldnd"
                     /gene_synonym="cldn29a; ns:zf-a310; zf-a310; zgc:101004"
                     /note="propagated from UniProtKB/Swiss-Prot (Q9YH91.1);
                     transmembrane region"
     misc_feature    488..550
                     /gene="cldnd"
                     /gene_synonym="cldn29a; ns:zf-a310; zf-a310; zgc:101004"
                     /note="propagated from UniProtKB/Swiss-Prot (Q9YH91.1);
                     transmembrane region"
ORIGIN      
aaaatctacaatggcatctgttgggcttcagcttctggccactgtcctggcgatcatcggctggttgggtgaaatcgtcatttgcgcgctgcccatgtggaaggtgacggctttcattggcaacaacatcgtgaccgcgcagattttctgggaaggcctctggatgaactgtgtgcagcaaagcacaggtcagatgcagtgcaaggtttatgactccatgctggctctacctcaagacctccaggccgcccgagctctcgtggtcatctccataatcgtcactttcatgggcgttttcctgaccatcgctggaggaaagtgcaccaactgcattgaggaccaggacgcgaaggctaaagtcgtggtcgccgctggagtgttcttcctggttggtggaattctttgtttgatcccggtgtgctggtccgcgaactccgtcatcaaggatttctacaaccccaccctgtccgatgctcagaaacgggagctgggagcgtcactcttcatcggctggtgcgcgtccggtctgctgctgctcggcggagcactgctctgctgccagtgcccgaagaacgagggtcgcgcttattctgttaagtactctgctcccaggtctgctccaggagcttatgtgtgacgcaccgactttctggactagtgttatcgtctcctgtttgtgtaggaagagatttttatgttttactttctggtcttgcatgaccgtttttaatttaataaacgtcttaatgattttt
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]