LOCUS       NM_131349                717 bp    mRNA    linear   VRT 07-MAY-2023
DEFINITION  Danio rerio HESX homeobox 1 (hesx1), mRNA.
ACCESSION   NM_131349
VERSION     NM_131349.1
KEYWORDS    RefSeq.
SOURCE      Danio rerio (zebrafish)
  ORGANISM  Danio rerio
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Actinopterygii; Neopterygii; Teleostei; Ostariophysi;
            Cypriniformes; Danionidae; Danioninae; Danio.
REFERENCE   1  (bases 1 to 717)
  AUTHORS   Okada K, Aoki K, Tabei T, Sugio K, Imai K, Bonkohara Y and Kamachi
            Y.
  TITLE     Key sequence features of CRISPR RNA for dual-guide CRISPR-Cas9
            ribonucleoprotein complexes assembled with wild-type or HiFi Cas9
  JOURNAL   Nucleic Acids Res 50 (5), 2854-2871 (2022)
   PUBMED   35166844
REFERENCE   2  (bases 1 to 717)
  AUTHORS   Young RM, Hawkins TA, Cavodeassi F, Stickney HL, Schwarz Q,
            Lawrence LM, Wierzbicki C, Cheng BY, Luo J, Ambrosio EM, Klosner A,
            Sealy IM, Rowell J, Trivedi CA, Bianco IH, Allende ML,
            Busch-Nentwich EM, Gestri G and Wilson SW.
  TITLE     Compensatory growth renders Tcf7l1a dispensable for eye formation
            despite its requirement in eye field specification
  JOURNAL   Elife 8, e40093 (2019)
   PUBMED   30777146
  REMARK    Publication Status: Online-Only
REFERENCE   3  (bases 1 to 717)
  AUTHORS   Nakayama Y, Inomata C, Yuikawa T, Tsuda S and Yamasu K.
  TITLE     Comprehensive analysis of target genes in zebrafish embryos reveals
            gbx2 involvement in neurogenesis
  JOURNAL   Dev Biol 430 (1), 237-248 (2017)
   PUBMED   28756106
REFERENCE   4  (bases 1 to 717)
  AUTHORS   Elkon R, Milon B, Morrison L, Shah M, Vijayakumar S, Racherla M,
            Leitch CC, Silipino L, Hadi S, Weiss-Gayet M, Barras E, Schmid CD,
            Ait-Lounis A, Barnes A, Song Y, Eisenman DJ, Eliyahu E, Frolenkov
            GI, Strome SE, Durand B, Zaghloul NA, Jones SM, Reith W and
            Hertzano R.
  TITLE     RFX transcription factors are essential for hearing in mice
  JOURNAL   Nat Commun 6, 8549 (2015)
   PUBMED   26469318
  REMARK    Publication Status: Online-Only
REFERENCE   5  (bases 1 to 717)
  AUTHORS   Zhu W, Yao X, Liang Y, Liang D, Song L, Jing N, Li J and Wang G.
  TITLE     Mediator Med23 deficiency enhances neural differentiation of murine
            embryonic stem cells through modulating BMP signaling
  JOURNAL   Development 142 (3), 465-476 (2015)
   PUBMED   25564654
REFERENCE   6  (bases 1 to 717)
  AUTHORS   Reim G and Brand M.
  TITLE     Spiel-ohne-grenzen/pou2 mediates regional competence to respond to
            Fgf8 during zebrafish early neural development
  JOURNAL   Development 129 (4), 917-933 (2002)
   PUBMED   11861475
REFERENCE   7  (bases 1 to 717)
  AUTHORS   Shinya M, Eschbach C, Clark M, Lehrach H and Furutani-Seiki M.
  TITLE     Zebrafish Dkk1, induced by the pre-MBT Wnt signaling, is secreted
            from the prechordal plate and patterns the anterior neural plate
  JOURNAL   Mech Dev 98 (1-2), 3-17 (2000)
   PUBMED   11044603
REFERENCE   8  (bases 1 to 717)
  AUTHORS   Ober EA and Schulte-Merker S.
  TITLE     Signals from the yolk cell induce mesoderm, neuroectoderm, the
            trunk organizer, and the notochord in zebrafish
  JOURNAL   Dev Biol 215 (2), 167-181 (1999)
   PUBMED   10545228
REFERENCE   9  (bases 1 to 717)
  AUTHORS   Barth KA, Kishimoto Y, Rohr KB, Seydler C, Schulte-Merker S and
            Wilson SW.
  TITLE     Bmp activity establishes a gradient of positional information
            throughout the entire neural plate
  JOURNAL   Development 126 (22), 4977-4987 (1999)
   PUBMED   10529416
REFERENCE   10 (bases 1 to 717)
  AUTHORS   Kazanskaya OV, Severtzova EA, Barth KA, Ermakova GV, Lukyanov SA,
            Benyumov AO, Pannese M, Boncinelli E, Wilson SW and Zaraisky AG.
  TITLE     Anf: a novel class of vertebrate homeobox genes expressed at the
            anterior end of the main embryonic axis
  JOURNAL   Gene 200 (1-2), 25-34 (1997)
   PUBMED   9373136
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from U65433.1.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: U65433.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA2168446, SAMEA2168447
                                           [ECO:0000348]
            ##Evidence-Data-END##
FEATURES             Location/Qualifiers
     source          1..717
                     /organism="Danio rerio"
                     /mol_type="mRNA"
                     /db_xref="taxon:7955"
                     /chromosome="11"
                     /map="11"
     gene            1..717
                     /gene="hesx1"
                     /gene_synonym="Anf; danf; zanf"
                     /note="HESX homeobox 1"
                     /db_xref="GeneID:30620"
                     /db_xref="ZFIN:ZDB-GENE-990415-130"
     CDS             39..524
                     /gene="hesx1"
                     /gene_synonym="Anf; danf; zanf"
                     /note="anterior neural folds homolog; homeo box (expressed
                     in ES cells) 1; anf1"
                     /codon_start=1
                     /product="homeobox expressed in ES cells 1"
                     /protein_id="NP_571424.1"
                     /db_xref="GeneID:30620"
                     /db_xref="ZFIN:ZDB-GENE-990415-130"
                     /translation="

MASLANSPSVFTIDSILGLDRPEQRTCPYRPWTDVKPACQNRRVVTESDAPVDVRENEDGKSFSKSPTDSYRRTLNWYIGRRPRTAFSSVQIKILESVFQVNSYPGIDIREELAKKLQLDEDRIQIWFQNRRAKLKRSHRESQFLMVKNVLNDLQIGREEH"

     misc_feature    279..449
                     /gene="hesx1"
                     /gene_synonym="Anf; danf; zanf"
                     /note="Region: Homeodomain; pfam00046"
                     /db_xref="CDD:459649"
ORIGIN      

gatcagttggagttaaattaaaggacttgagtttagcaatggcttctcttgcaaacagcccgtctgtgtttaccatcgacagcatcctgggactggatcgaccggagcagagaacatgtccttacaggccctggacagacgtgaagccagcatgtcagaatcgtcgagtggtgacagaaagtgatgctccagtggatgtgagagaaaatgaagatggtaaatctttcagtaaatcaccaactgactcgtacaggagaacactgaactggtacatcgggcgcaggccgagaacagccttctccagtgttcagatcaagatattagagagtgttttccaagtgaactcatacccaggtattgatatacgtgaagaacttgcaaagaagcttcaattagatgaggacagaatccagatttggttccagaacagaagagcaaagctgaagcgttcgcacagagagtcccagttcctcatggtgaaaaacgtcctcaacgatttacaaatcggcagagaagaacactgagagtagaactacattccttattattattattactattattattatcatcattattatttctctgttaccaaattgtaatttattaaatgtctttattaggtatgtctttttatgatttaaatgataaaaatacctattgttattttttattgtgtgtgtttggccaaaatataaataaataattctaaaactt

//