GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-11-01 14:30:10, GGRNA.v2 : RefSeq release 226 (Sep, 2024)

LOCUS       NM_001003464            1270 bp    mRNA    linear   VRT 15-APR-2024
DEFINITION  Danio rerio claudin k (cldnk), mRNA.
ACCESSION   NM_001003464
VERSION     NM_001003464.1
KEYWORDS    RefSeq.
SOURCE      Danio rerio (zebrafish)
  ORGANISM  Danio rerio
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Actinopterygii; Neopterygii; Teleostei; Ostariophysi;
            Cypriniformes; Danionidae; Danioninae; Danio.
REFERENCE   1  (bases 1 to 1270)
  AUTHORS   Spencer,S.A., Suarez-Pozos,E., Soto-Verdugo,J., Wang,H.,
            Afshari,F.S., Li,G., Manam,S., Yasuda,D., Ortega,A., Lister,J.A.,
            Ishii,S., Zhang,Y. and Fuss,B.
  TITLE     Lysophosphatidic acid signaling via LPA6 : A negative modulator of
            developmental oligodendrocyte maturation
  JOURNAL   J Neurochem 163 (6), 478-499 (2022)
   PUBMED   36153691
REFERENCE   2  (bases 1 to 1270)
  AUTHORS   Wiweger,M., Majewski,L., Adamek-Urbanska,D., Wasilewska,I. and
            Kuznicki,J.
  TITLE     npc2-Deficient Zebrafish Reproduce Neurological and Inflammatory
            Symptoms of Niemann-Pick Type C Disease
  JOURNAL   Front Cell Neurosci 15, 647860 (2021)
   PUBMED   33986646
  REMARK    Publication Status: Online-Only
REFERENCE   3  (bases 1 to 1270)
  AUTHORS   Nagarajan,B., Harder,A., Japp,A., Haberlein,F., Mingardo,E.,
            Kleinert,H., Yilmaz,O., Zoons,A., Rau,B., Christ,A.,
            Kubitscheck,U., Eiberger,B., Sandhoff,R., Eckhardt,M., Hartmann,D.
            and Odermatt,B.
  TITLE     CNS myelin protein 36K regulates oligodendrocyte differentiation
            through Notch
  JOURNAL   Glia 68 (3), 509-527 (2020)
   PUBMED   31702067
REFERENCE   4  (bases 1 to 1270)
  AUTHORS   Phan,V., Cox,D., Cipriani,S., Spendiff,S., Buchkremer,S.,
            O'Connor,E., Horvath,R., Goebel,H.H., Hathazi,D., Lochmuller,H.,
            Straka,T., Rudolf,R., Weis,J. and Roos,A.
  TITLE     SIL1 deficiency causes degenerative changes of peripheral nerves
            and neuromuscular junctions in fish, mice and human
  JOURNAL   Neurobiol Dis 124, 218-229 (2019)
   PUBMED   30468864
REFERENCE   5  (bases 1 to 1270)
  AUTHORS   Bayes,A., Collins,M.O., Reig-Viader,R., Gou,G., Goulding,D.,
            Izquierdo,A., Choudhary,J.S., Emes,R.D. and Grant,S.G.
  TITLE     Evolution of complexity in the zebrafish synapse proteome
  JOURNAL   Nat Commun 8, 14613 (2017)
   PUBMED   28252024
  REMARK    Publication Status: Online-Only
REFERENCE   6  (bases 1 to 1270)
  AUTHORS   Munzel,E.J., Schaefer,K., Obirei,B., Kremmer,E., Burton,E.A.,
            Kuscha,V., Becker,C.G., Brosamle,C., Williams,A. and Becker,T.
  TITLE     Claudin k is specifically expressed in cells that form myelin
            during development of the nervous system and regeneration of the
            optic nerve in adult zebrafish
  JOURNAL   Glia 60 (2), 253-270 (2012)
   PUBMED   22020875
  REMARK    GeneRIF: Claudin k is a novel myelin-associated protein expressed
            by oligodendrocytes and Schwann cells from early stages of myelin
            formation in zebrafish development and adult regeneration.
REFERENCE   7  (bases 1 to 1270)
  AUTHORS   Xie,J., Farage,E., Sugimoto,M. and Anand-Apte,B.
  TITLE     A novel transgenic zebrafish model for blood-brain and
            blood-retinal barrier development
  JOURNAL   BMC Dev Biol 10, 76 (2010)
   PUBMED   20653957
  REMARK    Publication Status: Online-Only
REFERENCE   8  (bases 1 to 1270)
  AUTHORS   Takada,N. and Appel,B.
  TITLE     Identification of genes expressed by zebrafish oligodendrocytes
            using a differential microarray screen
  JOURNAL   Dev Dyn 239 (7), 2041-2047 (2010)
   PUBMED   20549738
REFERENCE   9  (bases 1 to 1270)
  AUTHORS   Takada,N., Kucenas,S. and Appel,B.
  TITLE     Sox10 is necessary for oligodendrocyte survival following axon
            wrapping
  JOURNAL   Glia 58 (8), 996-1006 (2010)
   PUBMED   20229602
REFERENCE   10 (bases 1 to 1270)
  AUTHORS   Roberts,R.K. and Appel,B.
  TITLE     Apical polarity protein PrkCi is necessary for maintenance of
            spinal cord precursors in zebrafish
  JOURNAL   Dev Dyn 238 (7), 1638-1648 (2009)
   PUBMED   19449304
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from BC078365.1.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BC078365.1, EE690033.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA2168446, SAMEA2168447
                                           [ECO:0000348]
            ##Evidence-Data-END##
FEATURES             Location/Qualifiers
     source          1..1270
                     /organism="Danio rerio"
                     /mol_type="mRNA"
                     /db_xref="taxon:7955"
                     /chromosome="3"
                     /map="3"
     gene            1..1270
                     /gene="cldnk"
                     /gene_synonym="cldn31a; zgc:91878"
                     /note="claudin k"
                     /db_xref="GeneID:445070"
                     /db_xref="ZFIN:ZDB-GENE-040801-201"
     exon            1..215
                     /gene="cldnk"
                     /gene_synonym="cldn31a; zgc:91878"
                     /inference="alignment:Splign:2.1.0"
     exon            216..1246
                     /gene="cldnk"
                     /gene_synonym="cldn31a; zgc:91878"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    284..286
                     /gene="cldnk"
                     /gene_synonym="cldn31a; zgc:91878"
                     /note="upstream in-frame stop codon"
     CDS             371..1021
                     /gene="cldnk"
                     /gene_synonym="cldn31a; zgc:91878"
                     /note="claudin 31"
                     /codon_start=1
                     /product="claudin k"
                     /protein_id="NP_001003464.1"
                     /db_xref="GeneID:445070"
                     /db_xref="ZFIN:ZDB-GENE-040801-201"
                     /translation="
MATTGMQLLGLVLSIIGLVGGFLVCTLPMWRVTAFIGNNIVTAQITWEGLWMNCIWQSTGEIQCKGYDSLLALPSDMKAARGLTVLAILICSLSLTLGILGIKCTECVGLPSLKARLARVSGVLFVIAGFLILVPVCWTAHSIIRDFYDPYVAAPHKRELGPALYLGWGASALLLIGGSLLYAGSNPPGIPSSPTFSSDESSPRRAGGSSQVKGYV"
     misc_feature    380..913
                     /gene="cldnk"
                     /gene_synonym="cldn31a; zgc:91878"
                     /note="PMP-22/EMP/MP20/Claudin family; Region:
                     PMP22_Claudin; cl21598"
                     /db_xref="CDD:473919"
ORIGIN      
cccagagggcagcactttactcctgtcctcgccttccaaacgtgacattcaaccctagctgagcatctccatctacaggttacccctccattatatttctatggcatttcggctcaagctctggatccaggagcacaaaacaagaacctagaggattagcagatgagagactgaggtcggagataatcttcaaagtcttcactgtcactcatcaggtccattgcccagtctgtaccattcctttatcggaaaataacttgcaaaggaaaaagcttgactttggtgattcttgctgacattgcgtaccgaaggttctgtctgtgctctccattggactcatccaagtgatcattcttgggaaagattcaccatggcaaccaccggcatgcagctcctcggcctggtcctgtccatcattggccttgtggggggattcctggtgtgcaccctgcccatgtggagggtcacagccttcatcgggaacaacattgtaacggcacagatcacgtgggaaggtctctggatgaattgcatctggcaaagcacaggagagattcagtgcaaggggtatgacagcttgcttgctctacccagtgacatgaaggccgcccggggtcttacggttctcgctatactaatctgcagtctttcgctcacattaggtattctgggtatcaagtgcactgagtgcgtggggctcccaagcctcaaggctcgcttggcacgtgtgtccggtgtgctctttgtcattgcggggttcctcatccttgtgcctgtttgctggacggcccattccatcatcagggatttctatgacccctatgtggcggccccacacaaacgtgagcttggacccgctctctacttgggctggggggcttcggctttactgttgattggtggatcgcttctctatgcagggtccaatccacccgggattccctcttctcctacatttagcagtgatgagagcagcccacgccgagcgggtggttcttcccaggtcaagggttatgtttaatgaccaccacaggcacaccagtccccgaaagccttccctgttagagtttcccattgtgatagattgaagttaattttaatctattttgtatcaacagaatatttggagaggtagtgaatagaaatgtgaaatcaagttaccttgccacctctaatgtccacttataagtctgtctttctctgtatttgtctattatgttattcaataataaaaccttaaatcattaaaaaaaaaaaaaaaaaaaaaaaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]