2024-07-04 04:44:17, GGRNA.v2 : RefSeq release 224 (May, 2024)
LOCUS XM_018814698 956 bp mRNA linear INV 22-OCT-2018 DEFINITION PREDICTED: Ciona intestinalis uncharacterized LOC108950049 (LOC108950049), mRNA. ACCESSION XM_018814698 VERSION XM_018814698.2 DBLINK BioProject: PRJNA187185 KEYWORDS RefSeq. SOURCE Ciona intestinalis (vase tunicate) ORGANISM Ciona intestinalis Eukaryota; Metazoa; Chordata; Tunicata; Ascidiacea; Phlebobranchia; Cionidae; Ciona. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_020166.2) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Oct 22, 2018 this sequence version replaced XM_018814698.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Ciona intestinalis Annotation Release 104 Annotation Version :: 104 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.1 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..956 /organism="Ciona intestinalis" /mol_type="mRNA" /db_xref="taxon:7719" /chromosome="1" gene 1..956 /gene="LOC108950049" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 100% coverage of the annotated genomic feature by RNAseq alignments, including 14 samples with support for all annotated introns" /db_xref="GeneID:108950049" CDS 361..852 /gene="LOC108950049" /codon_start=1 /product="uncharacterized protein LOC108950049" /protein_id="XP_018670243.1" /db_xref="GeneID:108950049" /translation="
MVKSTELAAVIMFAFNLAACASCLFTTGWFVYTKDGIYHQKGLFLSCLDGSCNIDIVSQTVVANVTLGLMSVSCLGMLLGLAWLLVGIVHEKRQIVKIGSAVYILAGIGSFAAVMVYTGQTLISKSSPPPFGYSYALGWVAGIGGIVSGTVGLLASKKTYDVI"
misc_feature 376..807 /gene="LOC108950049" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:473919" ORIGIN
aaacgctgtatccttgcatttaaacatgttgtatttctccactacttatatcacgtatccggtgccggacaaagttaattaaaaggttagcgctaattaagggaaacggacacgcatatgcgacaacatgggacatgccgaatcacggcttgcttaaaaataaactgctcgtttgcacgtgaacagtatatacgtgcgcatttgtgtttttacatgcgaaaacaccaaaaaaggaagaatacttcaggagtcgaagtataaaaatcagatatagcagattgccagaaacagtttgcggaatattcagtatccgagtgtagtcaacaaaaaaacggagcttagaatataaagaaaattaaaatggtgaagtccactgaattggctgcagttattatgtttgcgtttaatctagccgcatgcgcctcgtgtctcttcacaaccggttggttcgtgtacacaaaagacggaatttatcaccagaaaggcttgtttctgtcttgtttggatggttcttgcaacattgatatagtgtctcaaacagttgttgccaacgtcacgcttggtttgatgtcagtttcttgccttggaatgctgctcggccttgcttggttgttggttggaattgttcacgaaaagaggcaaattgtaaagatcggttctgctgtttacattcttgcaggtattggatcgtttgcggctgtcatggtatatacaggtcaaacactgatttcaaagtcgtcgcctccgccctttggatacagttacgccttaggttgggtggcaggcatcggcggaattgtttctggcacggttggtttactagcgagtaagaagacatacgacgtcatataaaaatgtctgtattgagcaatttgagtgaaactttgtatattgtagtcacaacagtgggtgtgtggtttggcacagcagttttgtaataacagtttaagcaaata
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]