GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-07-01 07:51:26, GGRNA.v2 : RefSeq release 229 (Mar, 2025)

LOCUS       NM_203257                832 bp    mRNA    linear   PLN 20-OCT-2022
DEFINITION  Arabidopsis thaliana SAP domain-containing protein (AT5G63460),
            mRNA.
ACCESSION   NM_203257
VERSION     NM_203257.2
DBLINK      BioProject: PRJNA116
            BioSample: SAMN03081427
KEYWORDS    RefSeq.
SOURCE      Arabidopsis thaliana (thale cress)
  ORGANISM  Arabidopsis thaliana
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
            Pentapetalae; rosids; malvids; Brassicales; Brassicaceae;
            Camelineae; Arabidopsis.
REFERENCE   1  (bases 1 to 832)
  AUTHORS   Tabata,S., Kaneko,T., Nakamura,Y., Kotani,H., Kato,T., Asamizu,E.,
            Miyajima,N., Sasamoto,S., Kimura,T., Hosouchi,T., Kawashima,K.,
            Kohara,M., Matsumoto,M., Matsuno,A., Muraki,A., Nakayama,S.,
            Nakazaki,N., Naruo,K., Okumura,S., Shinpo,S., Takeuchi,C., Wada,T.,
            Watanabe,A., Yamada,M., Yasuda,M., Sato,S., de la Bastide,M.,
            Huang,E., Spiegel,L., Gnoj,L., O'Shaughnessy,A., Preston,R.,
            Habermann,K., Murray,J., Johnson,D., Rohlfing,T., Nelson,J.,
            Stoneking,T., Pepin,K., Spieth,J., Sekhon,M., Armstrong,J.,
            Becker,M., Belter,E., Cordum,H., Cordes,M., Courtney,L.,
            Courtney,W., Dante,M., Du,H., Edwards,J., Fryman,J., Haakensen,B.,
            Lamar,E., Latreille,P., Leonard,S., Meyer,R., Mulvaney,E.,
            Ozersky,P., Riley,A., Strowmatt,C., Wagner-McPherson,C., Wollam,A.,
            Yoakum,M., Bell,M., Dedhia,N., Parnell,L., Shah,R., Rodriguez,M.,
            See,L.H., Vil,D., Baker,J., Kirchoff,K., Toth,K., King,L.,
            Bahret,A., Miller,B., Marra,M., Martienssen,R., McCombie,W.R.,
            Wilson,R.K., Murphy,G., Bancroft,I., Volckaert,G., Wambutt,R.,
            Dusterhoft,A., Stiekema,W., Pohl,T., Entian,K.D., Terryn,N.,
            Hartley,N., Bent,E., Johnson,S., Langham,S.A., McCullagh,B.,
            Robben,J., Grymonprez,B., Zimmermann,W., Ramsperger,U., Wedler,H.,
            Balke,K., Wedler,E., Peters,S., van Staveren,M., Dirkse,W.,
            Mooijman,P., Lankhorst,R.K., Weitzenegger,T., Bothe,G., Rose,M.,
            Hauf,J., Berneiser,S., Hempel,S., Feldpausch,M., Lamberth,S.,
            Villarroel,R., Gielen,J., Ardiles,W., Bents,O., Lemcke,K.,
            Kolesov,G., Mayer,K., Rudd,S., Schoof,H., Schueller,C.,
            Zaccaria,P., Mewes,H.W., Bevan,M. and Fransz,P.
  CONSRTM   Kazusa DNA Research Institute; Cold Spring Harbor and Washington
            University in St Louis Sequencing Consortium; European Union
            Arabidopsis Genome Sequencing Consortium
  TITLE     Sequence and analysis of chromosome 5 of the plant Arabidopsis
            thaliana
  JOURNAL   Nature 408 (6814), 823-826 (2000)
   PUBMED   11130714
REFERENCE   2  (bases 1 to 832)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (19-OCT-2022) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 832)
  AUTHORS   Krishnakumar,V., Cheng,C.-Y., Chan,A.P., Schobel,S., Kim,M.,
            Ferlanti,E.S., Belyaeva,I., Rosen,B.D., Micklem,G., Miller,J.R.,
            Vaughn,M. and Town,C.D.
  TITLE     Direct Submission
  JOURNAL   Submitted (17-MAY-2016) Plant Genomics, J. Craig Venter Institute,
            9704 Medical Center Dr, Rockville, MD 20850, USA
  REMARK    Protein update by submitter
REFERENCE   4  (bases 1 to 832)
  AUTHORS   Swarbreck,D., Lamesch,P., Wilks,C. and Huala,E.
  CONSRTM   TAIR
  TITLE     Direct Submission
  JOURNAL   Submitted (18-FEB-2011) Department of Plant Biology, Carnegie
            Institution, 260 Panama Street, Stanford, CA, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by TAIR and Araport.
            This record is derived from an annotated genomic sequence
            (NC_003076).
            
            On Apr 18, 2007 this sequence version replaced NM_203257.1.
FEATURES             Location/Qualifiers
     source          1..832
                     /organism="Arabidopsis thaliana"
                     /mol_type="mRNA"
                     /db_xref="taxon:3702"
                     /chromosome="5"
                     /ecotype="Columbia"
     gene            1..832
                     /locus_tag="AT5G63460"
                     /gene_synonym="MLE2.9; MLE2_9"
                     /db_xref="Araport:AT5G63460"
                     /db_xref="GeneID:836465"
                     /db_xref="TAIR:AT5G63460"
     CDS             110..595
                     /locus_tag="AT5G63460"
                     /gene_synonym="MLE2.9; MLE2_9"
                     /inference="Similar to RNA sequence,
                     EST:INSD:ES060927.1,INSD:ES017831.1,INSD:EL005803.1,
                     INSD:ES117466.1,INSD:ES059921.1,INSD:ES018686.1,
                     INSD:ES214556.1,INSD:BP855168.1,INSD:EL978216.1,
                     INSD:ES200628.1,INSD:ES123845.1,INSD:EH838951.1"
                     /inference="similar to RNA sequence, mRNA:INSD:BX832954.1"
                     /note="SAP domain-containing protein; FUNCTIONS IN: DNA
                     binding, nucleic acid binding; INVOLVED IN:
                     biological_process unknown; LOCATED IN: nucleus,
                     chloroplast; EXPRESSED IN: male gametophyte, pollen tube;
                     EXPRESSED DURING: L mature pollen stage; CONTAINS InterPro
                     DOMAIN/s: DNA-binding SAP (InterPro:IPR003034), Ubiquitin
                     ligase, Det1/DDB1-complexing (InterPro:IPR018276); Has
                     35333 Blast hits to 34131 proteins in 2444 species: Archae
                     - 798; Bacteria - 22429; Metazoa - 974; Fungi - 991;
                     Plants - 531; Viruses - 0; Other Eukaryotes - 9610
                     (source: NCBI BLink)."
                     /codon_start=1
                     /product="SAP domain-containing protein"
                     /protein_id="NP_974986.1"
                     /db_xref="GeneID:836465"
                     /db_xref="TAIR:AT5G63460"
                     /db_xref="Araport:AT5G63460"
                     /translation="
MEASSSQPSDSSDQTASKFLSDLPSRGFLSSTVVSSNPGSLRVYICEHDTSPPEGQLIKTNQQNILIRSLLLKKQKGESSSKDSKGTAEDGPKKRAANRALDDRSSAKRAANASRQGSSSRTGERDFQSLTVEKLRAMLKEKGLPTKGRKDELIARLKSAN"
     misc_feature    161..337
                     /locus_tag="AT5G63460"
                     /gene_synonym="MLE2.9; MLE2_9"
                     /note="Det1 complexing ubiquitin ligase; Region: DDA1;
                     pfam10172"
                     /db_xref="CDD:401980"
     misc_feature    353..>589
                     /locus_tag="AT5G63460"
                     /gene_synonym="MLE2.9; MLE2_9"
                     /note="poly [ADP-ribose] polymerase; Provisional; Region:
                     PLN03124"
                     /db_xref="CDD:215591"
     misc_feature    488..589
                     /locus_tag="AT5G63460"
                     /gene_synonym="MLE2.9; MLE2_9"
                     /note="SAP domain; Region: SAP; pfam02037"
                     /db_xref="CDD:460424"
ORIGIN      
tgccgctttgttcctaaacgattttctgtctgttctctctttgctctctcgccctctcttgctcttctgggttcgtcttcctcggctagggtttatcagtggtttgtcaatggaggcttcatcatctcaaccatccgattcttctgatcaaactgcttccaagttcctttctgacctcccgtctcgaggtttcttgtcttctaccgtcgtctcttccaatccgggaagcttgcgggtctacatttgtgagcatgacacatctcccccagaaggacagcttatcaaaacaaaccagcaaaatatactaatcagatctctcttgttaaagaagcaaaaaggcgaatctagttctaaagactcaaaaggaactgctgaagatggtcctaaaaagagggctgcaaatagagctctggacgacagaagctcagctaaaagagctgctaatgcatctagacaaggatcaagcagtcgcacaggcgaaagagactttcagtctttgaccgttgagaagctccgcgccatgctcaaggagaagggccttccaacaaaaggaagaaaggatgagctcattgcgcgtctgaagagtgccaactgaaatgaagttgagaagggtgctctggtgaatatatgtatctttagaggtttcccaaataggagagaattgttgttgttcttgatcaaatacaaatccttttgatctcatctggagaatttgttatcaggaattaggctactttagtttatgaatccggtttggtgacatttgtaatatggatttcatcttttgataaagcaaaccaaaccaaaccaggcggtcttggttaattaaaaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]