2024-09-28 09:23:00, GGRNA.v2 : RefSeq release 225 (Jul, 2024)
LOCUS NM_202751 1297 bp mRNA linear PLN 20-OCT-2022 DEFINITION Arabidopsis thaliana double-stranded-RNA-binding protein 4 (DRB4), mRNA. ACCESSION NM_202751 VERSION NM_202751.1 DBLINK BioProject: PRJNA116 BioSample: SAMN03081427 KEYWORDS RefSeq. SOURCE Arabidopsis thaliana (thale cress) ORGANISM Arabidopsis thaliana Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis. REFERENCE 1 (bases 1 to 1297) AUTHORS Salanoubat,M., Lemcke,K., Rieger,M., Ansorge,W., Unseld,M., Fartmann,B., Valle,G., Blocker,H., Perez-Alonso,M., Obermaier,B., Delseny,M., Boutry,M., Grivell,L.A., Mache,R., Puigdomenech,P., De Simone,V., Choisne,N., Artiguenave,F., Robert,C., Brottier,P., Wincker,P., Cattolico,L., Weissenbach,J., Saurin,W., Quetier,F., Schafer,M., Muller-Auer,S., Gabel,C., Fuchs,M., Benes,V., Wurmbach,E., Drzonek,H., Erfle,H., Jordan,N., Bangert,S., Wiedelmann,R., Kranz,H., Voss,H., Holland,R., Brandt,P., Nyakatura,G., Vezzi,A., D'Angelo,M., Pallavicini,A., Toppo,S., Simionati,B., Conrad,A., Hornischer,K., Kauer,G., Lohnert,T.H., Nordsiek,G., Reichelt,J., Scharfe,M., Schon,O., Bargues,M., Terol,J., Climent,J., Navarro,P., Collado,C., Perez-Perez,A., Ottenwalder,B., Duchemin,D., Cooke,R., Laudie,M., Berger-Llauro,C., Purnelle,B., Masuy,D., de Haan,M., Maarse,A.C., Alcaraz,J.P., Cottet,A., Casacuberta,E., Monfort,A., Argiriou,A., flores,M., Liguori,R., Vitale,D., Mannhaupt,G., Haase,D., Schoof,H., Rudd,S., Zaccaria,P., Mewes,H.W., Mayer,K.F., Kaul,S., Town,C.D., Koo,H.L., Tallon,L.J., Jenkins,J., Rooney,T., Rizzo,M., Walts,A., Utterback,T., Fujii,C.Y., Shea,T.P., Creasy,T.H., Haas,B., Maiti,R., Wu,D., Peterson,J., Van Aken,S., Pai,G., Militscher,J., Sellers,P., Gill,J.E., Feldblyum,T.V., Preuss,D., Lin,X., Nierman,W.C., Salzberg,S.L., White,O., Venter,J.C., Fraser,C.M., Kaneko,T., Nakamura,Y., Sato,S., Kato,T., Asamizu,E., Sasamoto,S., Kimura,T., Idesawa,K., Kawashima,K., Kishida,Y., Kiyokawa,C., Kohara,M., Matsumoto,M., Matsuno,A., Muraki,A., Nakayama,S., Nakazaki,N., Shinpo,S., Takeuchi,C., Wada,T., Watanabe,A., Yamada,M., Yasuda,M. and Tabata,S. CONSRTM European Union Chromosome 3 Arabidopsis Sequencing Consortium; Institute for Genomic Research; Kazusa DNA Research Institute TITLE Sequence and analysis of chromosome 3 of the plant Arabidopsis thaliana JOURNAL Nature 408 (6814), 820-822 (2000) PUBMED 11130713 REFERENCE 2 (bases 1 to 1297) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (19-OCT-2022) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 3 (bases 1 to 1297) AUTHORS Krishnakumar,V., Cheng,C.-Y., Chan,A.P., Schobel,S., Kim,M., Ferlanti,E.S., Belyaeva,I., Rosen,B.D., Micklem,G., Miller,J.R., Vaughn,M. and Town,C.D. TITLE Direct Submission JOURNAL Submitted (17-MAY-2016) Plant Genomics, J. Craig Venter Institute, 9704 Medical Center Dr, Rockville, MD 20850, USA REMARK Protein update by submitter REFERENCE 4 (bases 1 to 1297) AUTHORS Swarbreck,D., Lamesch,P., Wilks,C. and Huala,E. CONSRTM TAIR TITLE Direct Submission JOURNAL Submitted (18-FEB-2011) Department of Plant Biology, Carnegie Institution, 260 Panama Street, Stanford, CA, USA COMMENT REVIEWED REFSEQ: This record has been curated by TAIR and Araport. This record is derived from an annotated genomic sequence (NC_003074). FEATURES Location/Qualifiers source 1..1297 /organism="Arabidopsis thaliana" /mol_type="mRNA" /db_xref="taxon:3702" /chromosome="3" /ecotype="Columbia" gene 1..1297 /gene="DRB4" /locus_tag="AT3G62800" /gene_synonym="ATTIF3K1; double-stranded-RNA-binding protein 4" /note="Encodes a nuclear dsRNA-binding protein DRB4 that interacts specifically with DCL4. May regulate DCL4 function and thereby affect miRNA biogenesis. Also has an impact on polymerase IV-dependent siRNA levels. DRB4 interacts with the P6 viral protein from Cauliflower mosaic virus and may be a target of viral silencing suppression." /db_xref="Araport:AT3G62800" /db_xref="GeneID:825455" /db_xref="TAIR:AT3G62800" CDS 73..1140 /gene="DRB4" /locus_tag="AT3G62800" /gene_synonym="ATTIF3K1; double-stranded-RNA-binding protein 4" /inference="Similar to RNA sequence, EST:INSD:AV789028.1,INSD:EG490615.1,INSD:EL317902.1, INSD:EL298579.1,INSD:EL986072.1,INSD:EH831297.1, INSD:EL001686.1,INSD:EH975965.1,INSD:EH816638.1, INSD:EG519674.1,INSD:EL987543.1" /inference="Similar to RNA sequence, mRNA:INSD:BX823891.1,INSD:AY150509.1" /note="double-stranded-RNA-binding protein 4 (DRB4); FUNCTIONS IN: double-stranded RNA binding, protein binding; INVOLVED IN: production of ta-siRNAs involved in RNA interference; LOCATED IN: nucleus; EXPRESSED IN: 25 plant structures; EXPRESSED DURING: 15 growth stages; CONTAINS InterPro DOMAIN/s: Double-stranded RNA-binding (InterPro:IPR001159), Double-stranded RNA-binding-like (InterPro:IPR014720); BEST Arabidopsis thaliana protein match is: dsRNA-binding protein 3 (TAIR:AT3G26932.2); Has 35333 Blast hits to 34131 proteins in 2444 species: Archae - 798; Bacteria - 22429; Metazoa - 974; Fungi - 991; Plants - 531; Viruses - 0; Other Eukaryotes - 9610 (source: NCBI BLink)." /codon_start=1 /product="double-stranded-RNA-binding protein 4" /protein_id="NP_974480.1" /db_xref="GeneID:825455" /db_xref="TAIR:AT3G62800" /db_xref="Araport:AT3G62800" /translation="
MDHVYKGQLQAYALQHNLELPVYANEREGPPHAPRFRCNVTFCGQTFQSSEFFPTLKSAEHAAAKIAVASLTPQSPEGIDVAYKNLLQEIAQKESSLLPFYATATSGPSHAPTFTSTVEFAGKVFSGEEAKTKKLAEMSAAKVAFMSIKNGNSNQTGSPTLPSERQEDVNSNVKSSPQEIHSQPSSKVVMTPDTPSKGIKVNEDEFPDLHDAPASNAKEINVALNEPENPTNDGTLSALTTDGMKMNIASSSLPIPHNPTNVITLNAPAANGIKRNIAACSSWMPQNPTNDGSETSSCVVDESEKKKLIMGTGHLSIPTGQHVVCRPWNPEITLPQDAEMLFRDDKFIAYRLVKP"
misc_feature 82..288 /gene="DRB4" /locus_tag="AT3G62800" /gene_synonym="ATTIF3K1; double-stranded-RNA-binding protein 4" /note="first double-stranded RNA binding motif of Arabidopsis thaliana double-stranded RNA-binding proteins (AtDRBs)and similar proteins; Region: DSRM_AtDRB-like_rpt1; cd19907" /db_xref="CDD:380736" misc_feature order(94..96,100..105,112..117,130..135,160..174,178..180, 232..243,250..255) /gene="DRB4" /locus_tag="AT3G62800" /gene_synonym="ATTIF3K1; double-stranded-RNA-binding protein 4" /note="putative RNA binding site [nucleotide binding]; other site" /db_xref="CDD:380736" misc_feature 313..519 /gene="DRB4" /locus_tag="AT3G62800" /gene_synonym="ATTIF3K1; double-stranded-RNA-binding protein 4" /note="second double-stranded RNA binding motif of Arabidopsis thaliana double-stranded RNA-binding proteins (AtDRBs)and similar proteins; Region: DSRM_AtDRB-like_rpt2; cd19908" /db_xref="CDD:380737" misc_feature order(328..330,334..339,346..351,364..369,394..408, 412..414,463..474,481..486) /gene="DRB4" /locus_tag="AT3G62800" /gene_synonym="ATTIF3K1; double-stranded-RNA-binding protein 4" /note="putative RNA binding site [nucleotide binding]; other site" /db_xref="CDD:380737" ORIGIN
caatcagcgaatgctttgtctgattgttcacttcctccctcgaagtgtcttcaccatttcaaagagatagagatggatcatgtatacaaaggtcaactgcaagcgtatgccctgcaacataatctggagctaccagtgtatgcgaatgagagagaagggcctcctcatgctcctagatttagatgtaatgttacattctgtggacagactttccagagctctgaattctttccgacactaaaatcggctgaacatgccgctgcaaaaattgcagttgcttctttgacgccacaaagtccagagggaattgatgttgcctacaagaacctgttacaagaaattgcacagaaagagagttctctgttaccattttatgcaactgctacatctggtccatcgcatgcgcctacttttacttcaactgttgagtttgctggtaaagttttcagtggagaagaggcgaaaaccaaaaagttggctgaaatgagcgctgctaaagttgcattcatgagtatcaaaaatgggaactcgaaccagaccggatcgcctactttgcctagtgagagacaagaagatgtaaattcaaatgtgaagagcagtccacaagagatccattctcaaccttcttccaaggtggtgatgacccctgataccccatcaaaggggattaaagtgaatgaagatgaatttccagatcttcatgatgcaccagccagtaatgctaaggagattaacgttgctttgaatgagcctgagaatcctacaaacgatggtactcttagtgcactaactactgatggtatgaagatgaacattgcttcttcttctttgcctatacctcacaatcctacaaacgttattactcttaatgcaccagctgccaatggtatcaagaggaacattgctgcttgttcttcgtggatgcctcagaatcccacaaacgatggtagtgaaacatcatcatgtgtagtagatgagagtgagaaaaagaagctcataatgggaactggccacctgagtataccaactggccaacatgtagtttgtcgcccatggaaccccgagataactcttcctcaagacgcggagatgctctttagagatgataaatttatagcctatcgtcttgtgaagccataacgacatcatcatctttgatgcataataagtgtagagatagaatgttaaggtaagctatatctcatctgtttgtagaaatagaatgcttctcgtctctggttttcttaagcaatatgctatgtagtatgtatactgtgtaatgactaatttttgtttt
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]