GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-12-09 12:45:13, GGRNA.v2 : RefSeq release 232 (Sep, 2025)

LOCUS       NM_125474                442 bp    mRNA    linear   PLN 20-OCT-2022
DEFINITION  Arabidopsis thaliana root meristem growth factor 1 (RGF1), mRNA.
ACCESSION   NM_125474
VERSION     NM_125474.4
DBLINK      BioProject: PRJNA116
            BioSample: SAMN03081427
KEYWORDS    RefSeq.
SOURCE      Arabidopsis thaliana (thale cress)
  ORGANISM  Arabidopsis thaliana
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
            Pentapetalae; rosids; malvids; Brassicales; Brassicaceae;
            Camelineae; Arabidopsis.
REFERENCE   1  (bases 1 to 442)
  AUTHORS   Tabata,S., Kaneko,T., Nakamura,Y., Kotani,H., Kato,T., Asamizu,E.,
            Miyajima,N., Sasamoto,S., Kimura,T., Hosouchi,T., Kawashima,K.,
            Kohara,M., Matsumoto,M., Matsuno,A., Muraki,A., Nakayama,S.,
            Nakazaki,N., Naruo,K., Okumura,S., Shinpo,S., Takeuchi,C., Wada,T.,
            Watanabe,A., Yamada,M., Yasuda,M., Sato,S., de la Bastide,M.,
            Huang,E., Spiegel,L., Gnoj,L., O'Shaughnessy,A., Preston,R.,
            Habermann,K., Murray,J., Johnson,D., Rohlfing,T., Nelson,J.,
            Stoneking,T., Pepin,K., Spieth,J., Sekhon,M., Armstrong,J.,
            Becker,M., Belter,E., Cordum,H., Cordes,M., Courtney,L.,
            Courtney,W., Dante,M., Du,H., Edwards,J., Fryman,J., Haakensen,B.,
            Lamar,E., Latreille,P., Leonard,S., Meyer,R., Mulvaney,E.,
            Ozersky,P., Riley,A., Strowmatt,C., Wagner-McPherson,C., Wollam,A.,
            Yoakum,M., Bell,M., Dedhia,N., Parnell,L., Shah,R., Rodriguez,M.,
            See,L.H., Vil,D., Baker,J., Kirchoff,K., Toth,K., King,L.,
            Bahret,A., Miller,B., Marra,M., Martienssen,R., McCombie,W.R.,
            Wilson,R.K., Murphy,G., Bancroft,I., Volckaert,G., Wambutt,R.,
            Dusterhoft,A., Stiekema,W., Pohl,T., Entian,K.D., Terryn,N.,
            Hartley,N., Bent,E., Johnson,S., Langham,S.A., McCullagh,B.,
            Robben,J., Grymonprez,B., Zimmermann,W., Ramsperger,U., Wedler,H.,
            Balke,K., Wedler,E., Peters,S., van Staveren,M., Dirkse,W.,
            Mooijman,P., Lankhorst,R.K., Weitzenegger,T., Bothe,G., Rose,M.,
            Hauf,J., Berneiser,S., Hempel,S., Feldpausch,M., Lamberth,S.,
            Villarroel,R., Gielen,J., Ardiles,W., Bents,O., Lemcke,K.,
            Kolesov,G., Mayer,K., Rudd,S., Schoof,H., Schueller,C.,
            Zaccaria,P., Mewes,H.W., Bevan,M. and Fransz,P.
  CONSRTM   Kazusa DNA Research Institute; Cold Spring Harbor and Washington
            University in St Louis Sequencing Consortium; European Union
            Arabidopsis Genome Sequencing Consortium
  TITLE     Sequence and analysis of chromosome 5 of the plant Arabidopsis
            thaliana
  JOURNAL   Nature 408 (6814), 823-826 (2000)
   PUBMED   11130714
REFERENCE   2  (bases 1 to 442)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (19-OCT-2022) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 442)
  AUTHORS   Krishnakumar,V., Cheng,C.-Y., Chan,A.P., Schobel,S., Kim,M.,
            Ferlanti,E.S., Belyaeva,I., Rosen,B.D., Micklem,G., Miller,J.R.,
            Vaughn,M. and Town,C.D.
  TITLE     Direct Submission
  JOURNAL   Submitted (17-MAY-2016) Plant Genomics, J. Craig Venter Institute,
            9704 Medical Center Dr, Rockville, MD 20850, USA
  REMARK    Protein update by submitter
REFERENCE   4  (bases 1 to 442)
  AUTHORS   Swarbreck,D., Lamesch,P., Wilks,C. and Huala,E.
  CONSRTM   TAIR
  TITLE     Direct Submission
  JOURNAL   Submitted (18-FEB-2011) Department of Plant Biology, Carnegie
            Institution, 260 Panama Street, Stanford, CA, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by TAIR and Araport.
            This record is derived from an annotated genomic sequence
            (NC_003076).
            
            On Sep 12, 2016 this sequence version replaced NM_125474.3.
FEATURES             Location/Qualifiers
     source          1..442
                     /organism="Arabidopsis thaliana"
                     /mol_type="mRNA"
                     /db_xref="taxon:3702"
                     /chromosome="5"
                     /ecotype="Columbia"
     gene            1..442
                     /gene="RGF1"
                     /locus_tag="AT5G60810"
                     /gene_synonym="GLV11; GOLVEN 11; MAE1.14; MAE1_14; root
                     meristem growth factor 1"
                     /note="Encodes a root meristem growth factor (RGF).
                     Belongs to a family of functionally redundant homologous
                     peptides that are secreted, tyrosine-sulfated, and
                     expressed mainly in the stem cell area and the innermost
                     layer of central columella cells. RGFs are required for
                     maintenance of the root stem cell niche and transit
                     amplifying cell proliferation. Members of this family
                     include: At5g60810 (RGF1), At1g13620 (RGF2), At2g04025
                     (RGF3), At3g30350 (RGF4), At5g51451 (RGF5), At4g16515
                     (RGF6), At3g02240 (RGF7), At2g03830 (RGF8) and At5g64770
                     (RGF9)."
                     /db_xref="Araport:AT5G60810"
                     /db_xref="GeneID:836202"
                     /db_xref="TAIR:AT5G60810"
     CDS             70..420
                     /gene="RGF1"
                     /locus_tag="AT5G60810"
                     /gene_synonym="GLV11; GOLVEN 11; MAE1.14; MAE1_14; root
                     meristem growth factor 1"
                     /inference="Similar to RNA sequence,
                     EST:INSD:EG475372.1,INSD:EG475349.1,INSD:EG475365.1,
                     INSD:EG475360.1,INSD:EG475351.1,INSD:EG475358.1,
                     INSD:EG475373.1,INSD:EG475350.1,INSD:EG475363.1,
                     INSD:EG475370.1,INSD:EG475357.1,INSD:EG475366.1,
                     INSD:EG475367.1,INSD:EG475371.1,INSD:EG475362.1,
                     INSD:EG475361.1,INSD:EG475359.1"
                     /inference="similar to RNA sequence,
                     mRNA:INSD:DQ653385.1,INSD:DQ447098.1"
                     /note="root meristem growth factor 1 (RGF1); FUNCTIONS IN:
                     molecular_function unknown; INVOLVED IN: regulation of
                     root meristem growth, positive regulation of gene
                     expression; LOCATED IN: endomembrane system; EXPRESSED IN:
                     columella root cap initial cell, quiescent center; Has 4
                     Blast hits to 4 proteins in 2 species: Archae - 0;
                     Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 4; Viruses
                     - 0; Other Eukaryotes - 0 (source: NCBI BLink)."
                     /codon_start=1
                     /product="root meristem growth factor 1"
                     /protein_id="NP_200889.2"
                     /db_xref="GeneID:836202"
                     /db_xref="TAIR:AT5G60810"
                     /db_xref="Araport:AT5G60810"
                     /translation="
MVSIRVICYLLVFSVLQVHAKVSNANFNSQAPQMKNSEGLGASNGTQIAKKHAEDVIENRKTLKHVNVKVEANEKNGLEIESKEMVKKRKNKKRLTKTESLTADYSNPGHHPPRHN"
ORIGIN      
aaaacacacaagtttactcttttctgttcatatacgtacatcaagccaaggagaaaaaaggaaggcgagatggtgtccataagggttatttgctatcttttagtattttccgttttgcaggtgcatgctaaagtctccaatgcaaactttaatagccaagctccacaaatgaaaaatagtgaaggtcttggagcaagcaatggtacccaaattgccaagaagcatgctgaagatgtaattgaaaaccgaaagacgttgaagcatgtaaatgtgaaggtggaggcaaatgagaagaatggtttagaaatagagagtaaagaaatggtgaagaaaagaaaaaacaagaagagactcaccaagacggagagtttaactgccgattatagcaaccctggtcatcatcctcctaggcataactaaaacatatatatatatatatata
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]