LOCUS       NM_114963                704 bp    mRNA    linear   PLN 20-OCT-2022
DEFINITION  Arabidopsis thaliana thioredoxin H-type 1 (TRX1), mRNA.
ACCESSION   NM_114963
VERSION     NM_114963.5
DBLINK      BioProject: PRJNA116
            BioSample: SAMN03081427
KEYWORDS    RefSeq.
SOURCE      Arabidopsis thaliana (thale cress)
  ORGANISM  Arabidopsis thaliana
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
            Pentapetalae; rosids; malvids; Brassicales; Brassicaceae;
            Camelineae; Arabidopsis.
REFERENCE   1  (bases 1 to 704)
  AUTHORS   Salanoubat,M., Lemcke,K., Rieger,M., Ansorge,W., Unseld,M.,
            Fartmann,B., Valle,G., Blocker,H., Perez-Alonso,M., Obermaier,B.,
            Delseny,M., Boutry,M., Grivell,L.A., Mache,R., Puigdomenech,P., De
            Simone,V., Choisne,N., Artiguenave,F., Robert,C., Brottier,P.,
            Wincker,P., Cattolico,L., Weissenbach,J., Saurin,W., Quetier,F.,
            Schafer,M., Muller-Auer,S., Gabel,C., Fuchs,M., Benes,V.,
            Wurmbach,E., Drzonek,H., Erfle,H., Jordan,N., Bangert,S.,
            Wiedelmann,R., Kranz,H., Voss,H., Holland,R., Brandt,P.,
            Nyakatura,G., Vezzi,A., D'Angelo,M., Pallavicini,A., Toppo,S.,
            Simionati,B., Conrad,A., Hornischer,K., Kauer,G., Lohnert,T.H.,
            Nordsiek,G., Reichelt,J., Scharfe,M., Schon,O., Bargues,M.,
            Terol,J., Climent,J., Navarro,P., Collado,C., Perez-Perez,A.,
            Ottenwalder,B., Duchemin,D., Cooke,R., Laudie,M., Berger-Llauro,C.,
            Purnelle,B., Masuy,D., de Haan,M., Maarse,A.C., Alcaraz,J.P.,
            Cottet,A., Casacuberta,E., Monfort,A., Argiriou,A., flores,M.,
            Liguori,R., Vitale,D., Mannhaupt,G., Haase,D., Schoof,H., Rudd,S.,
            Zaccaria,P., Mewes,H.W., Mayer,K.F., Kaul,S., Town,C.D., Koo,H.L.,
            Tallon,L.J., Jenkins,J., Rooney,T., Rizzo,M., Walts,A.,
            Utterback,T., Fujii,C.Y., Shea,T.P., Creasy,T.H., Haas,B.,
            Maiti,R., Wu,D., Peterson,J., Van Aken,S., Pai,G., Militscher,J.,
            Sellers,P., Gill,J.E., Feldblyum,T.V., Preuss,D., Lin,X.,
            Nierman,W.C., Salzberg,S.L., White,O., Venter,J.C., Fraser,C.M.,
            Kaneko,T., Nakamura,Y., Sato,S., Kato,T., Asamizu,E., Sasamoto,S.,
            Kimura,T., Idesawa,K., Kawashima,K., Kishida,Y., Kiyokawa,C.,
            Kohara,M., Matsumoto,M., Matsuno,A., Muraki,A., Nakayama,S.,
            Nakazaki,N., Shinpo,S., Takeuchi,C., Wada,T., Watanabe,A.,
            Yamada,M., Yasuda,M. and Tabata,S.
  CONSRTM   European Union Chromosome 3 Arabidopsis Sequencing Consortium;
            Institute for Genomic Research; Kazusa DNA Research Institute
  TITLE     Sequence and analysis of chromosome 3 of the plant Arabidopsis
            thaliana
  JOURNAL   Nature 408 (6814), 820-822 (2000)
   PUBMED   11130713
REFERENCE   2  (bases 1 to 704)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (19-OCT-2022) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 704)
  AUTHORS   Krishnakumar,V., Cheng,C.-Y., Chan,A.P., Schobel,S., Kim,M.,
            Ferlanti,E.S., Belyaeva,I., Rosen,B.D., Micklem,G., Miller,J.R.,
            Vaughn,M. and Town,C.D.
  TITLE     Direct Submission
  JOURNAL   Submitted (17-MAY-2016) Plant Genomics, J. Craig Venter Institute,
            9704 Medical Center Dr, Rockville, MD 20850, USA
  REMARK    Protein update by submitter
REFERENCE   4  (bases 1 to 704)
  AUTHORS   Swarbreck,D., Lamesch,P., Wilks,C. and Huala,E.
  CONSRTM   TAIR
  TITLE     Direct Submission
  JOURNAL   Submitted (18-FEB-2011) Department of Plant Biology, Carnegie
            Institution, 260 Panama Street, Stanford, CA, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by TAIR and Araport.
            This record is derived from an annotated genomic sequence
            (NC_003074).
            
            On Sep 12, 2016 this sequence version replaced NM_114963.4.
FEATURES             Location/Qualifiers
     source          1..704
                     /organism="Arabidopsis thaliana"
                     /mol_type="mRNA"
                     /db_xref="taxon:3702"
                     /chromosome="3"
                     /ecotype="Columbia"
     gene            1..704
                     /gene="TRX1"
                     /locus_tag="AT3G51030"
                     /gene_synonym="ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1;
                     ATTRX H1; ATTRX1; THIOREDOXIN; thioredoxin H-type 1"
                     /note="encodes a cytosolic thioredoxin that reduces
                     disulfide bridges of target proteins by the reversible
                     formation of a disulfide bridge between two neighboring
                     Cys residues present in the active site. Thioredoxins have
                     been found to regulate a variety of biological reactions
                     in prokaryotic and eukaryotic cells."
                     /db_xref="Araport:AT3G51030"
                     /db_xref="GeneID:824267"
                     /db_xref="TAIR:AT3G51030"
     CDS             155..499
                     /gene="TRX1"
                     /locus_tag="AT3G51030"
                     /gene_synonym="ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1;
                     ATTRX H1; ATTRX1; THIOREDOXIN; thioredoxin H-type 1"
                     /inference="Similar to RNA sequence,
                     EST:INSD:DR322271.1,INSD:EH881320.1,INSD:ES051740.1,
                     INSD:DR371494.1,INSD:DR301300.1,INSD:DR322273.1,
                     INSD:DR374664.1,INSD:DR224540.1,INSD:DR322270.1,
                     INSD:DR322272.1,INSD:DR322269.1"
                     /inference="Similar to RNA sequence,
                     mRNA:INSD:AY088687.1,INSD:BX842165.1,INSD:Z14084.1"
                     /note="thioredoxin H-type 1 (TRX1); FUNCTIONS IN:
                     oxidoreductase activity, acting on sulfur group of donors,
                     disulfide as acceptor; INVOLVED IN: cell redox
                     homeostasis; LOCATED IN: cytosol; EXPRESSED IN: 20 plant
                     structures; EXPRESSED DURING: 14 growth stages; CONTAINS
                     InterPro DOMAIN/s: Thioredoxin fold (InterPro:IPR012335),
                     Thioredoxin, core (InterPro:IPR015467), Thioredoxin domain
                     (InterPro:IPR013766), Thioredoxin, conserved site
                     (InterPro:IPR017937), Thioredoxin-like subdomain
                     (InterPro:IPR006662), Thioredoxin-like
                     (InterPro:IPR017936), Thioredoxin-like fold
                     (InterPro:IPR012336); BEST Arabidopsis thaliana protein
                     match is: thioredoxin H-type 5 (TAIR:AT1G45145.1); Has
                     18017 Blast hits to 17697 proteins in 2965 species: Archae
                     - 232; Bacteria - 9905; Metazoa - 1876; Fungi - 909;
                     Plants - 1960; Viruses - 5; Other Eukaryotes - 3130
                     (source: NCBI BLink)."
                     /codon_start=1
                     /product="thioredoxin H-type 1"
                     /protein_id="NP_190672.1"
                     /db_xref="GeneID:824267"
                     /db_xref="TAIR:AT3G51030"
                     /db_xref="Araport:AT3G51030"
                     /translation="

MASEEGQVIACHTVETWNEQLQKANESKTLVVVDFTASWCGPCRFIAPFFADLAKKLPNVLFLKVDTDELKSVASDWAIQAMPTFMFLKEGKILDKVVGAKKDELQSTIAKHLA"

     misc_feature    209..484
                     /gene="TRX1"
                     /locus_tag="AT3G51030"
                     /gene_synonym="ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1;
                     ATTRX H1; ATTRX1; THIOREDOXIN; thioredoxin H-type 1"
                     /note="TRX family; composed of two groups: Group I, which
                     includes proteins that exclusively encode a TRX domain;
                     and Group II, which are composed of fusion proteins of TRX
                     and additional domains. Group I TRX is a small ancient
                     protein that alter the redox...; Region: TRX_family;
                     cd02947"
                     /db_xref="CDD:239245"
     misc_feature    order(272..274,281..283)
                     /gene="TRX1"
                     /locus_tag="AT3G51030"
                     /gene_synonym="ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1;
                     ATTRX H1; ATTRX1; THIOREDOXIN; thioredoxin H-type 1"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:239245"
ORIGIN      

aattatgggaaacaaaatcacgcgtcgaataaagtagaagagaaaaactattgacgggcaaaattgggattggtaggtgacgcgcatgctaagtaattgaaaaaaaaaaaacacaagaggagaagaaacagaacagagaagaaaaagagagaagatggcttcggaagaaggacaagtgatcgcctgccacaccgttgagacatggaacgagcagcttcagaaggctaatgaatccaaaactcttgtggtggttgatttcacggcttcttggtgtggaccatgtcgtttcatcgctccattctttgctgatttggctaagaaacttcctaacgtgcttttcctcaaggttgatactgatgaattgaagtcggtggcaagtgattgggcgatacaggcgatgccaaccttcatgtttttgaaggaagggaagattttggacaaagttgttggagccaagaaagatgagcttcagtctaccattgccaaacacttggcttaagctttccactcttatatatctcttaagatgttggattaattgttctattactcttgacatgttataacttgttcccctttgttatggttccggtctataatctcatctgactatttgaagctgaaaattgctttgcttatccagtaaatcaattactttgtgacttcaaagtatatttgaaaactaatttctacattatgtcctc

//