LOCUS       NM_113195                989 bp    mRNA    linear   PLN 20-OCT-2022
DEFINITION  Arabidopsis thaliana ADP-ribosylation factor C1 (ARFC1), mRNA.
ACCESSION   NM_113195
VERSION     NM_113195.4
DBLINK      BioProject: PRJNA116
            BioSample: SAMN03081427
KEYWORDS    RefSeq.
SOURCE      Arabidopsis thaliana (thale cress)
  ORGANISM  Arabidopsis thaliana
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
            Pentapetalae; rosids; malvids; Brassicales; Brassicaceae;
            Camelineae; Arabidopsis.
REFERENCE   1  (bases 1 to 989)
  AUTHORS   Salanoubat,M., Lemcke,K., Rieger,M., Ansorge,W., Unseld,M.,
            Fartmann,B., Valle,G., Blocker,H., Perez-Alonso,M., Obermaier,B.,
            Delseny,M., Boutry,M., Grivell,L.A., Mache,R., Puigdomenech,P., De
            Simone,V., Choisne,N., Artiguenave,F., Robert,C., Brottier,P.,
            Wincker,P., Cattolico,L., Weissenbach,J., Saurin,W., Quetier,F.,
            Schafer,M., Muller-Auer,S., Gabel,C., Fuchs,M., Benes,V.,
            Wurmbach,E., Drzonek,H., Erfle,H., Jordan,N., Bangert,S.,
            Wiedelmann,R., Kranz,H., Voss,H., Holland,R., Brandt,P.,
            Nyakatura,G., Vezzi,A., D'Angelo,M., Pallavicini,A., Toppo,S.,
            Simionati,B., Conrad,A., Hornischer,K., Kauer,G., Lohnert,T.H.,
            Nordsiek,G., Reichelt,J., Scharfe,M., Schon,O., Bargues,M.,
            Terol,J., Climent,J., Navarro,P., Collado,C., Perez-Perez,A.,
            Ottenwalder,B., Duchemin,D., Cooke,R., Laudie,M., Berger-Llauro,C.,
            Purnelle,B., Masuy,D., de Haan,M., Maarse,A.C., Alcaraz,J.P.,
            Cottet,A., Casacuberta,E., Monfort,A., Argiriou,A., flores,M.,
            Liguori,R., Vitale,D., Mannhaupt,G., Haase,D., Schoof,H., Rudd,S.,
            Zaccaria,P., Mewes,H.W., Mayer,K.F., Kaul,S., Town,C.D., Koo,H.L.,
            Tallon,L.J., Jenkins,J., Rooney,T., Rizzo,M., Walts,A.,
            Utterback,T., Fujii,C.Y., Shea,T.P., Creasy,T.H., Haas,B.,
            Maiti,R., Wu,D., Peterson,J., Van Aken,S., Pai,G., Militscher,J.,
            Sellers,P., Gill,J.E., Feldblyum,T.V., Preuss,D., Lin,X.,
            Nierman,W.C., Salzberg,S.L., White,O., Venter,J.C., Fraser,C.M.,
            Kaneko,T., Nakamura,Y., Sato,S., Kato,T., Asamizu,E., Sasamoto,S.,
            Kimura,T., Idesawa,K., Kawashima,K., Kishida,Y., Kiyokawa,C.,
            Kohara,M., Matsumoto,M., Matsuno,A., Muraki,A., Nakayama,S.,
            Nakazaki,N., Shinpo,S., Takeuchi,C., Wada,T., Watanabe,A.,
            Yamada,M., Yasuda,M. and Tabata,S.
  CONSRTM   European Union Chromosome 3 Arabidopsis Sequencing Consortium;
            Institute for Genomic Research; Kazusa DNA Research Institute
  TITLE     Sequence and analysis of chromosome 3 of the plant Arabidopsis
            thaliana
  JOURNAL   Nature 408 (6814), 820-822 (2000)
   PUBMED   11130713
REFERENCE   2  (bases 1 to 989)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (19-OCT-2022) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 989)
  AUTHORS   Krishnakumar,V., Cheng,C.-Y., Chan,A.P., Schobel,S., Kim,M.,
            Ferlanti,E.S., Belyaeva,I., Rosen,B.D., Micklem,G., Miller,J.R.,
            Vaughn,M. and Town,C.D.
  TITLE     Direct Submission
  JOURNAL   Submitted (17-MAY-2016) Plant Genomics, J. Craig Venter Institute,
            9704 Medical Center Dr, Rockville, MD 20850, USA
  REMARK    Protein update by submitter
REFERENCE   4  (bases 1 to 989)
  AUTHORS   Swarbreck,D., Lamesch,P., Wilks,C. and Huala,E.
  CONSRTM   TAIR
  TITLE     Direct Submission
  JOURNAL   Submitted (18-FEB-2011) Department of Plant Biology, Carnegie
            Institution, 260 Panama Street, Stanford, CA, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by TAIR and Araport.
            This record is derived from an annotated genomic sequence
            (NC_003074).
            
            On May 26, 2011 this sequence version replaced NM_113195.3.
FEATURES             Location/Qualifiers
     source          1..989
                     /organism="Arabidopsis thaliana"
                     /mol_type="mRNA"
                     /db_xref="taxon:3702"
                     /chromosome="3"
                     /ecotype="Columbia"
     gene            1..989
                     /gene="ARFC1"
                     /locus_tag="AT3G22950"
                     /gene_synonym="ADP-ribosylation factor C1; ATARFC1"
                     /note="A member of ARF GTPase family. A thaliana has 21
                     members of this family, known to be essential for vesicle
                     coating and uncoating and functions in GTP-binding. Gene
                     encoding ADP-ribosylation factor and similar to
                     ADP-ribosylation factor GB:P91924 (Dugesia japonica),
                     other ARFs and ARF-like proteins."
                     /db_xref="Araport:AT3G22950"
                     /db_xref="GeneID:821868"
                     /db_xref="TAIR:AT3G22950"
     CDS             256..807
                     /gene="ARFC1"
                     /locus_tag="AT3G22950"
                     /gene_synonym="ADP-ribosylation factor C1; ATARFC1"
                     /inference="Similar to RNA sequence,
                     EST:INSD:DR314655.1,INSD:DR314659.1,INSD:BP836177.1,
                     INSD:EH910302.1,INSD:AV824466.1,INSD:BP863232.1,
                     INSD:DR314665.1,INSD:DR373751.1,INSD:BP577121.1,
                     INSD:DR314662.1,INSD:EL116961.1,INSD:EL003534.1,
                     INSD:EL273099.1,INSD:AV786254.1,INSD:EL105501.1,
                     INSD:AU227019.1,INSD:DR314664.1,INSD:DR314652.1,
                     INSD:DR314660.1,INSD:DR314661.1,INSD:ES021581.1,
                     INSD:ES122929.1,INSD:DR314656.1,INSD:EH963556.1,
                     INSD:DR314658.1,INSD:EH985131.1,INSD:DR314663.1,
                     INSD:BP827794.1,INSD:BP655823.1,INSD:ES150032.1,
                     INSD:ES045948.1,INSD:DR314666.1,INSD:DR314653.1,
                     INSD:ES154085.1,INSD:DR314654.1,INSD:BP640417.1,
                     INSD:DR314651.1,INSD:DR314657.1,INSD:EH875922.1,
                     INSD:EL973712.1,INSD:EL000255.1,INSD:ES039248.1"
                     /inference="Similar to RNA sequence,
                     mRNA:INSD:AY063958.1,INSD:AY096401.1,INSD:BX825336.1,
                     INSD:AY086337.1"
                     /note="ADP-ribosylation factor C1 (ARFC1); FUNCTIONS IN:
                     GTP binding; INVOLVED IN: N-terminal protein
                     myristoylation; LOCATED IN: endomembrane system,
                     intracellular; EXPRESSED IN: 24 plant structures;
                     EXPRESSED DURING: 15 growth stages; CONTAINS InterPro
                     DOMAIN/s: ADP-ribosylation factor (InterPro:IPR006688),
                     Small GTP-binding protein (InterPro:IPR005225), ARF/SAR
                     superfamily (InterPro:IPR006689); BEST Arabidopsis
                     thaliana protein match is: ADP-ribosylation factor 1
                     (TAIR:AT1G23490.1); Has 17774 Blast hits to 17763 proteins
                     in 550 species: Archae - 23; Bacteria - 45; Metazoa -
                     8202; Fungi - 2537; Plants - 2915; Viruses - 3; Other
                     Eukaryotes - 4049 (source: NCBI BLink)."
                     /codon_start=1
                     /product="ADP-ribosylation factor C1"
                     /protein_id="NP_188935.1"
                     /db_xref="GeneID:821868"
                     /db_xref="TAIR:AT3G22950"
                     /db_xref="Araport:AT3G22950"
                     /translation="

MGAFMSRFWFMMFPAKEYKIVVVGLDNAGKTTTLYKLHLGEVVTTHPTVGSNVEELVYKNIRFEVWDLGGQDRLRTSWATYYRGTHAVIVVIDSTDRARISFMKDELARLLGHEDLQNSVILVFANKQDLKDAMTPAEITDALNLHSIKNHDWHIQASCAVTGEGLYDGLGWIAQKVTGKATS"

     misc_feature    262..783
                     /gene="ARFC1"
                     /locus_tag="AT3G22950"
                     /gene_synonym="ADP-ribosylation factor C1; ATARFC1"
                     /note="Arf-like 5 (Arl5) and 8 (Arl8) GTPases; Region:
                     Arl5_Arl8; cd04153"
                     /db_xref="CDD:133353"
     misc_feature    325..348
                     /gene="ARFC1"
                     /locus_tag="AT3G22950"
                     /gene_synonym="ADP-ribosylation factor C1; ATARFC1"
                     /note="G1 box; other site"
                     /db_xref="CDD:133353"
     misc_feature    order(331..351,631..636,640..642,730..735)
                     /gene="ARFC1"
                     /locus_tag="AT3G22950"
                     /gene_synonym="ADP-ribosylation factor C1; ATARFC1"
                     /note="GTP/Mg2+ binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:133353"
     misc_feature    order(331..336,346..348,358..360,394..417,481..483,
                     496..498)
                     /gene="ARFC1"
                     /locus_tag="AT3G22950"
                     /gene_synonym="ADP-ribosylation factor C1; ATARFC1"
                     /note="putative GAP interaction site [polypeptide
                     binding]; other site"
                     /db_xref="CDD:133353"
     misc_feature    361..408
                     /gene="ARFC1"
                     /locus_tag="AT3G22950"
                     /gene_synonym="ADP-ribosylation factor C1; ATARFC1"
                     /note="Switch I region; other site"
                     /db_xref="CDD:133353"
     misc_feature    order(397..411,424..426,454..456,466..468,484..486,
                     490..498)
                     /gene="ARFC1"
                     /locus_tag="AT3G22950"
                     /gene_synonym="ADP-ribosylation factor C1; ATARFC1"
                     /note="putative GEF interaction site [polypeptide
                     binding]; other site"
                     /db_xref="CDD:133353"
     misc_feature    397..399
                     /gene="ARFC1"
                     /locus_tag="AT3G22950"
                     /gene_synonym="ADP-ribosylation factor C1; ATARFC1"
                     /note="G2 box; other site"
                     /db_xref="CDD:133353"
     misc_feature    order(400..423,451..453,484..486,493..498)
                     /gene="ARFC1"
                     /locus_tag="AT3G22950"
                     /gene_synonym="ADP-ribosylation factor C1; ATARFC1"
                     /note="putative effector interaction site [active]"
                     /db_xref="CDD:133353"
     misc_feature    order(409..429,436..453)
                     /gene="ARFC1"
                     /locus_tag="AT3G22950"
                     /gene_synonym="ADP-ribosylation factor C1; ATARFC1"
                     /note="interswitch region [active]"
                     /db_xref="CDD:133353"
     misc_feature    454..507
                     /gene="ARFC1"
                     /locus_tag="AT3G22950"
                     /gene_synonym="ADP-ribosylation factor C1; ATARFC1"
                     /note="Switch II region; other site"
                     /db_xref="CDD:133353"
     misc_feature    454..465
                     /gene="ARFC1"
                     /locus_tag="AT3G22950"
                     /gene_synonym="ADP-ribosylation factor C1; ATARFC1"
                     /note="G3 box; other site"
                     /db_xref="CDD:133353"
     misc_feature    631..642
                     /gene="ARFC1"
                     /locus_tag="AT3G22950"
                     /gene_synonym="ADP-ribosylation factor C1; ATARFC1"
                     /note="G4 box; other site"
                     /db_xref="CDD:133353"
     misc_feature    730..738
                     /gene="ARFC1"
                     /locus_tag="AT3G22950"
                     /gene_synonym="ADP-ribosylation factor C1; ATARFC1"
                     /note="G5 box; other site"
                     /db_xref="CDD:133353"
ORIGIN      

cgtctttggcgtcgtggctaatggcggtgacgtgttcggtgccattacggtagaggctgcagccgtttggttttgacattgtttcccgcatacttttcttcttcttcttctctccacccatctgctttaaggaaggaacctcaaaagcttacaaaatagtagaagaagaactttttttgatctccgattcttacctctgcaatcttcagattctagctgattcaaggatcttgtttgtgatagaaattggaggagatgggagcattcatgtcgaggttttggttcatgatgtttcctgcaaaagagtataagattgttgttgttggtttggataatgctggtaaaacgacgacgctttataaacttcatttgggtgaagttgttactactcatcctactgttggtagcaatgttgaagagcttgtctacaagaatattcgctttgaggtatgggatcttggtgggcaagataggctaagaacttcatgggcaacatactatcgtggaacacatgctgtgattgtggttatagatagcacagacagagccagaatctctttcatgaaagatgagctagccaggttacttggtcatgaggatcttcaaaactcggtcatactagtttttgcaaacaaacaggatctgaaagacgcaatgactcctgctgagatcacggatgcacttaaccttcacagtatcaagaaccatgattggcatattcaagcaagttgtgcggttactggagaaggattgtatgatgggctcggttggattgcccaaaaagttaccggtaaagccacgagttaaggggaaaccagaactgaatcagagagagtacgtactattcttctttgtttcttttgtctccttcatatgttctttaacattgtatcctcttgacttttatgtaacaagcttcaactattttggttgctctcattgaaactgtgtccagaattttcatatatggaagaaaaaaatcttgtttt

//