ver.2
Home
|
Help
|
Advanced search
Previous release (v1)
2026-09-25 10:15:17, GGRNA.v2 : RefSeq release 233 (Jan, 2026)
LOCUS NM_113195 989 bp mRNA linear PLN 20-OCT-2022
DEFINITION Arabidopsis thaliana ADP-ribosylation factor C1 (ARFC1), mRNA.
ACCESSION NM_113195
VERSION NM_113195.4
DBLINK BioProject: PRJNA116
BioSample: SAMN03081427
KEYWORDS RefSeq.
SOURCE Arabidopsis thaliana (thale cress)
ORGANISM Arabidopsis thaliana
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
Pentapetalae; rosids; malvids; Brassicales; Brassicaceae;
Camelineae; Arabidopsis.
REFERENCE 1 (bases 1 to 989)
AUTHORS Salanoubat,M., Lemcke,K., Rieger,M., Ansorge,W., Unseld,M.,
Fartmann,B., Valle,G., Blocker,H., Perez-Alonso,M., Obermaier,B.,
Delseny,M., Boutry,M., Grivell,L.A., Mache,R., Puigdomenech,P., De
Simone,V., Choisne,N., Artiguenave,F., Robert,C., Brottier,P.,
Wincker,P., Cattolico,L., Weissenbach,J., Saurin,W., Quetier,F.,
Schafer,M., Muller-Auer,S., Gabel,C., Fuchs,M., Benes,V.,
Wurmbach,E., Drzonek,H., Erfle,H., Jordan,N., Bangert,S.,
Wiedelmann,R., Kranz,H., Voss,H., Holland,R., Brandt,P.,
Nyakatura,G., Vezzi,A., D'Angelo,M., Pallavicini,A., Toppo,S.,
Simionati,B., Conrad,A., Hornischer,K., Kauer,G., Lohnert,T.H.,
Nordsiek,G., Reichelt,J., Scharfe,M., Schon,O., Bargues,M.,
Terol,J., Climent,J., Navarro,P., Collado,C., Perez-Perez,A.,
Ottenwalder,B., Duchemin,D., Cooke,R., Laudie,M., Berger-Llauro,C.,
Purnelle,B., Masuy,D., de Haan,M., Maarse,A.C., Alcaraz,J.P.,
Cottet,A., Casacuberta,E., Monfort,A., Argiriou,A., flores,M.,
Liguori,R., Vitale,D., Mannhaupt,G., Haase,D., Schoof,H., Rudd,S.,
Zaccaria,P., Mewes,H.W., Mayer,K.F., Kaul,S., Town,C.D., Koo,H.L.,
Tallon,L.J., Jenkins,J., Rooney,T., Rizzo,M., Walts,A.,
Utterback,T., Fujii,C.Y., Shea,T.P., Creasy,T.H., Haas,B.,
Maiti,R., Wu,D., Peterson,J., Van Aken,S., Pai,G., Militscher,J.,
Sellers,P., Gill,J.E., Feldblyum,T.V., Preuss,D., Lin,X.,
Nierman,W.C., Salzberg,S.L., White,O., Venter,J.C., Fraser,C.M.,
Kaneko,T., Nakamura,Y., Sato,S., Kato,T., Asamizu,E., Sasamoto,S.,
Kimura,T., Idesawa,K., Kawashima,K., Kishida,Y., Kiyokawa,C.,
Kohara,M., Matsumoto,M., Matsuno,A., Muraki,A., Nakayama,S.,
Nakazaki,N., Shinpo,S., Takeuchi,C., Wada,T., Watanabe,A.,
Yamada,M., Yasuda,M. and Tabata,S.
CONSRTM European Union Chromosome 3 Arabidopsis Sequencing Consortium;
Institute for Genomic Research; Kazusa DNA Research Institute
TITLE Sequence and analysis of chromosome 3 of the plant Arabidopsis
thaliana
JOURNAL Nature 408 (6814), 820-822 (2000)
PUBMED 11130713
REFERENCE 2 (bases 1 to 989)
CONSRTM NCBI Genome Project
TITLE Direct Submission
JOURNAL Submitted (19-OCT-2022) National Center for Biotechnology
Information, NIH, Bethesda, MD 20894, USA
REFERENCE 3 (bases 1 to 989)
AUTHORS Krishnakumar,V., Cheng,C.-Y., Chan,A.P., Schobel,S., Kim,M.,
Ferlanti,E.S., Belyaeva,I., Rosen,B.D., Micklem,G., Miller,J.R.,
Vaughn,M. and Town,C.D.
TITLE Direct Submission
JOURNAL Submitted (17-MAY-2016) Plant Genomics, J. Craig Venter Institute,
9704 Medical Center Dr, Rockville, MD 20850, USA
REMARK Protein update by submitter
REFERENCE 4 (bases 1 to 989)
AUTHORS Swarbreck,D., Lamesch,P., Wilks,C. and Huala,E.
CONSRTM TAIR
TITLE Direct Submission
JOURNAL Submitted (18-FEB-2011) Department of Plant Biology, Carnegie
Institution, 260 Panama Street, Stanford, CA, USA
COMMENT REVIEWED REFSEQ: This record has been curated by TAIR and Araport.
This record is derived from an annotated genomic sequence
(NC_003074).
On May 26, 2011 this sequence version replaced NM_113195.3.
FEATURES Location/Qualifiers
source 1..989
/organism="Arabidopsis thaliana"
/mol_type="mRNA"
/db_xref="taxon:3702"
/chromosome="3"
/ecotype="Columbia"
gene 1..989
/gene="ARFC1"
/locus_tag="AT3G22950"
/gene_synonym="ADP-ribosylation factor C1; ATARFC1"
/note="A member of ARF GTPase family. A thaliana has 21
members of this family, known to be essential for vesicle
coating and uncoating and functions in GTP-binding. Gene
encoding ADP-ribosylation factor and similar to
ADP-ribosylation factor GB:P91924 (Dugesia japonica),
other ARFs and ARF-like proteins."
/db_xref="Araport:AT3G22950"
/db_xref="GeneID:821868"
/db_xref="TAIR:AT3G22950"
CDS 256..807
/gene="ARFC1"
/locus_tag="AT3G22950"
/gene_synonym="ADP-ribosylation factor C1; ATARFC1"
/inference="Similar to RNA sequence,
EST:INSD:DR314655.1,INSD:DR314659.1,INSD:BP836177.1,
INSD:EH910302.1,INSD:AV824466.1,INSD:BP863232.1,
INSD:DR314665.1,INSD:DR373751.1,INSD:BP577121.1,
INSD:DR314662.1,INSD:EL116961.1,INSD:EL003534.1,
INSD:EL273099.1,INSD:AV786254.1,INSD:EL105501.1,
INSD:AU227019.1,INSD:DR314664.1,INSD:DR314652.1,
INSD:DR314660.1,INSD:DR314661.1,INSD:ES021581.1,
INSD:ES122929.1,INSD:DR314656.1,INSD:EH963556.1,
INSD:DR314658.1,INSD:EH985131.1,INSD:DR314663.1,
INSD:BP827794.1,INSD:BP655823.1,INSD:ES150032.1,
INSD:ES045948.1,INSD:DR314666.1,INSD:DR314653.1,
INSD:ES154085.1,INSD:DR314654.1,INSD:BP640417.1,
INSD:DR314651.1,INSD:DR314657.1,INSD:EH875922.1,
INSD:EL973712.1,INSD:EL000255.1,INSD:ES039248.1"
/inference="Similar to RNA sequence,
mRNA:INSD:AY063958.1,INSD:AY096401.1,INSD:BX825336.1,
INSD:AY086337.1"
/note="ADP-ribosylation factor C1 (ARFC1); FUNCTIONS IN:
GTP binding; INVOLVED IN: N-terminal protein
myristoylation; LOCATED IN: endomembrane system,
intracellular; EXPRESSED IN: 24 plant structures;
EXPRESSED DURING: 15 growth stages; CONTAINS InterPro
DOMAIN/s: ADP-ribosylation factor (InterPro:IPR006688),
Small GTP-binding protein (InterPro:IPR005225), ARF/SAR
superfamily (InterPro:IPR006689); BEST Arabidopsis
thaliana protein match is: ADP-ribosylation factor 1
(TAIR:AT1G23490.1); Has 17774 Blast hits to 17763 proteins
in 550 species: Archae - 23; Bacteria - 45; Metazoa -
8202; Fungi - 2537; Plants - 2915; Viruses - 3; Other
Eukaryotes - 4049 (source: NCBI BLink)."
/codon_start=1
/product="ADP-ribosylation factor C1"
/protein_id="NP_188935.1"
/db_xref="GeneID:821868"
/db_xref="TAIR:AT3G22950"
/db_xref="Araport:AT3G22950"
/translation="
MGAFMSRFWFMMFPAKEYKIVVVGLDNAGKTTTLYKLHLGEVVTTHPTVGSNVEELVYKNIRFEVWDLGGQDRLRTSWATYYRGTHAVIVVIDSTDRARISFMKDELARLLGHEDLQNSVILVFANKQDLKDAMTPAEITDALNLHSIKNHDWHIQASCAVTGEGLYDGLGWIAQKVTGKATS"
misc_feature 262..783
/gene="ARFC1"
/locus_tag="AT3G22950"
/gene_synonym="ADP-ribosylation factor C1; ATARFC1"
/note="Arf-like 5 (Arl5) and 8 (Arl8) GTPases; Region:
Arl5_Arl8; cd04153"
/db_xref="CDD:133353"
misc_feature 325..348
/gene="ARFC1"
/locus_tag="AT3G22950"
/gene_synonym="ADP-ribosylation factor C1; ATARFC1"
/note="G1 box; other site"
/db_xref="CDD:133353"
misc_feature order(331..351,631..636,640..642,730..735)
/gene="ARFC1"
/locus_tag="AT3G22950"
/gene_synonym="ADP-ribosylation factor C1; ATARFC1"
/note="GTP/Mg2+ binding site [chemical binding]; other
site"
/db_xref="CDD:133353"
misc_feature order(331..336,346..348,358..360,394..417,481..483,
496..498)
/gene="ARFC1"
/locus_tag="AT3G22950"
/gene_synonym="ADP-ribosylation factor C1; ATARFC1"
/note="putative GAP interaction site [polypeptide
binding]; other site"
/db_xref="CDD:133353"
misc_feature 361..408
/gene="ARFC1"
/locus_tag="AT3G22950"
/gene_synonym="ADP-ribosylation factor C1; ATARFC1"
/note="Switch I region; other site"
/db_xref="CDD:133353"
misc_feature order(397..411,424..426,454..456,466..468,484..486,
490..498)
/gene="ARFC1"
/locus_tag="AT3G22950"
/gene_synonym="ADP-ribosylation factor C1; ATARFC1"
/note="putative GEF interaction site [polypeptide
binding]; other site"
/db_xref="CDD:133353"
misc_feature 397..399
/gene="ARFC1"
/locus_tag="AT3G22950"
/gene_synonym="ADP-ribosylation factor C1; ATARFC1"
/note="G2 box; other site"
/db_xref="CDD:133353"
misc_feature order(400..423,451..453,484..486,493..498)
/gene="ARFC1"
/locus_tag="AT3G22950"
/gene_synonym="ADP-ribosylation factor C1; ATARFC1"
/note="putative effector interaction site [active]"
/db_xref="CDD:133353"
misc_feature order(409..429,436..453)
/gene="ARFC1"
/locus_tag="AT3G22950"
/gene_synonym="ADP-ribosylation factor C1; ATARFC1"
/note="interswitch region [active]"
/db_xref="CDD:133353"
misc_feature 454..507
/gene="ARFC1"
/locus_tag="AT3G22950"
/gene_synonym="ADP-ribosylation factor C1; ATARFC1"
/note="Switch II region; other site"
/db_xref="CDD:133353"
misc_feature 454..465
/gene="ARFC1"
/locus_tag="AT3G22950"
/gene_synonym="ADP-ribosylation factor C1; ATARFC1"
/note="G3 box; other site"
/db_xref="CDD:133353"
misc_feature 631..642
/gene="ARFC1"
/locus_tag="AT3G22950"
/gene_synonym="ADP-ribosylation factor C1; ATARFC1"
/note="G4 box; other site"
/db_xref="CDD:133353"
misc_feature 730..738
/gene="ARFC1"
/locus_tag="AT3G22950"
/gene_synonym="ADP-ribosylation factor C1; ATARFC1"
/note="G5 box; other site"
/db_xref="CDD:133353"
ORIGIN
cgtctttggcgtcgtggctaatggcggtgacgtgttcggtgccattacggtagaggctgcagccgtttggttttgacattgtttcccgcatacttttcttcttcttcttctctccacccatctgctttaaggaaggaacctcaaaagcttacaaaatagtagaagaagaactttttttgatctccgattcttacctctgcaatcttcagattctagctgattcaaggatcttgtttgtgatagaaattggaggagatgggagcattcatgtcgaggttttggttcatgatgtttcctgcaaaagagtataagattgttgttgttggtttggataatgctggtaaaacgacgacgctttataaacttcatttgggtgaagttgttactactcatcctactgttggtagcaatgttgaagagcttgtctacaagaatattcgctttgaggtatgggatcttggtgggcaagataggctaagaacttcatgggcaacatactatcgtggaacacatgctgtgattgtggttatagatagcacagacagagccagaatctctttcatgaaagatgagctagccaggttacttggtcatgaggatcttcaaaactcggtcatactagtttttgcaaacaaacaggatctgaaagacgcaatgactcctgctgagatcacggatgcacttaaccttcacagtatcaagaaccatgattggcatattcaagcaagttgtgcggttactggagaaggattgtatgatgggctcggttggattgcccaaaaagttaccggtaaagccacgagttaaggggaaaccagaactgaatcagagagagtacgtactattcttctttgtttcttttgtctccttcatatgttctttaacattgtatcctcttgacttttatgtaacaagcttcaactattttggttgctctcattgaaactgtgtccagaattttcatatatggaagaaaaaaatcttgtttt
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]