2025-09-18 05:31:04, GGRNA.v2 : RefSeq release 231 (Jul, 2025)
LOCUS NM_113195 989 bp mRNA linear PLN 20-OCT-2022 DEFINITION Arabidopsis thaliana ADP-ribosylation factor C1 (ARFC1), mRNA. ACCESSION NM_113195 VERSION NM_113195.4 DBLINK BioProject: PRJNA116 BioSample: SAMN03081427 KEYWORDS RefSeq. SOURCE Arabidopsis thaliana (thale cress) ORGANISM Arabidopsis thaliana Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis. REFERENCE 1 (bases 1 to 989) AUTHORS Salanoubat,M., Lemcke,K., Rieger,M., Ansorge,W., Unseld,M., Fartmann,B., Valle,G., Blocker,H., Perez-Alonso,M., Obermaier,B., Delseny,M., Boutry,M., Grivell,L.A., Mache,R., Puigdomenech,P., De Simone,V., Choisne,N., Artiguenave,F., Robert,C., Brottier,P., Wincker,P., Cattolico,L., Weissenbach,J., Saurin,W., Quetier,F., Schafer,M., Muller-Auer,S., Gabel,C., Fuchs,M., Benes,V., Wurmbach,E., Drzonek,H., Erfle,H., Jordan,N., Bangert,S., Wiedelmann,R., Kranz,H., Voss,H., Holland,R., Brandt,P., Nyakatura,G., Vezzi,A., D'Angelo,M., Pallavicini,A., Toppo,S., Simionati,B., Conrad,A., Hornischer,K., Kauer,G., Lohnert,T.H., Nordsiek,G., Reichelt,J., Scharfe,M., Schon,O., Bargues,M., Terol,J., Climent,J., Navarro,P., Collado,C., Perez-Perez,A., Ottenwalder,B., Duchemin,D., Cooke,R., Laudie,M., Berger-Llauro,C., Purnelle,B., Masuy,D., de Haan,M., Maarse,A.C., Alcaraz,J.P., Cottet,A., Casacuberta,E., Monfort,A., Argiriou,A., flores,M., Liguori,R., Vitale,D., Mannhaupt,G., Haase,D., Schoof,H., Rudd,S., Zaccaria,P., Mewes,H.W., Mayer,K.F., Kaul,S., Town,C.D., Koo,H.L., Tallon,L.J., Jenkins,J., Rooney,T., Rizzo,M., Walts,A., Utterback,T., Fujii,C.Y., Shea,T.P., Creasy,T.H., Haas,B., Maiti,R., Wu,D., Peterson,J., Van Aken,S., Pai,G., Militscher,J., Sellers,P., Gill,J.E., Feldblyum,T.V., Preuss,D., Lin,X., Nierman,W.C., Salzberg,S.L., White,O., Venter,J.C., Fraser,C.M., Kaneko,T., Nakamura,Y., Sato,S., Kato,T., Asamizu,E., Sasamoto,S., Kimura,T., Idesawa,K., Kawashima,K., Kishida,Y., Kiyokawa,C., Kohara,M., Matsumoto,M., Matsuno,A., Muraki,A., Nakayama,S., Nakazaki,N., Shinpo,S., Takeuchi,C., Wada,T., Watanabe,A., Yamada,M., Yasuda,M. and Tabata,S. CONSRTM European Union Chromosome 3 Arabidopsis Sequencing Consortium; Institute for Genomic Research; Kazusa DNA Research Institute TITLE Sequence and analysis of chromosome 3 of the plant Arabidopsis thaliana JOURNAL Nature 408 (6814), 820-822 (2000) PUBMED 11130713 REFERENCE 2 (bases 1 to 989) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (19-OCT-2022) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 3 (bases 1 to 989) AUTHORS Krishnakumar,V., Cheng,C.-Y., Chan,A.P., Schobel,S., Kim,M., Ferlanti,E.S., Belyaeva,I., Rosen,B.D., Micklem,G., Miller,J.R., Vaughn,M. and Town,C.D. TITLE Direct Submission JOURNAL Submitted (17-MAY-2016) Plant Genomics, J. Craig Venter Institute, 9704 Medical Center Dr, Rockville, MD 20850, USA REMARK Protein update by submitter REFERENCE 4 (bases 1 to 989) AUTHORS Swarbreck,D., Lamesch,P., Wilks,C. and Huala,E. CONSRTM TAIR TITLE Direct Submission JOURNAL Submitted (18-FEB-2011) Department of Plant Biology, Carnegie Institution, 260 Panama Street, Stanford, CA, USA COMMENT REVIEWED REFSEQ: This record has been curated by TAIR and Araport. This record is derived from an annotated genomic sequence (NC_003074). On May 26, 2011 this sequence version replaced NM_113195.3. FEATURES Location/Qualifiers source 1..989 /organism="Arabidopsis thaliana" /mol_type="mRNA" /db_xref="taxon:3702" /chromosome="3" /ecotype="Columbia" gene 1..989 /gene="ARFC1" /locus_tag="AT3G22950" /gene_synonym="ADP-ribosylation factor C1; ATARFC1" /note="A member of ARF GTPase family. A thaliana has 21 members of this family, known to be essential for vesicle coating and uncoating and functions in GTP-binding. Gene encoding ADP-ribosylation factor and similar to ADP-ribosylation factor GB:P91924 (Dugesia japonica), other ARFs and ARF-like proteins." /db_xref="Araport:AT3G22950" /db_xref="GeneID:821868" /db_xref="TAIR:AT3G22950" CDS 256..807 /gene="ARFC1" /locus_tag="AT3G22950" /gene_synonym="ADP-ribosylation factor C1; ATARFC1" /inference="Similar to RNA sequence, EST:INSD:DR314655.1,INSD:DR314659.1,INSD:BP836177.1, INSD:EH910302.1,INSD:AV824466.1,INSD:BP863232.1, INSD:DR314665.1,INSD:DR373751.1,INSD:BP577121.1, INSD:DR314662.1,INSD:EL116961.1,INSD:EL003534.1, INSD:EL273099.1,INSD:AV786254.1,INSD:EL105501.1, INSD:AU227019.1,INSD:DR314664.1,INSD:DR314652.1, INSD:DR314660.1,INSD:DR314661.1,INSD:ES021581.1, INSD:ES122929.1,INSD:DR314656.1,INSD:EH963556.1, INSD:DR314658.1,INSD:EH985131.1,INSD:DR314663.1, INSD:BP827794.1,INSD:BP655823.1,INSD:ES150032.1, INSD:ES045948.1,INSD:DR314666.1,INSD:DR314653.1, INSD:ES154085.1,INSD:DR314654.1,INSD:BP640417.1, INSD:DR314651.1,INSD:DR314657.1,INSD:EH875922.1, INSD:EL973712.1,INSD:EL000255.1,INSD:ES039248.1" /inference="Similar to RNA sequence, mRNA:INSD:AY063958.1,INSD:AY096401.1,INSD:BX825336.1, INSD:AY086337.1" /note="ADP-ribosylation factor C1 (ARFC1); FUNCTIONS IN: GTP binding; INVOLVED IN: N-terminal protein myristoylation; LOCATED IN: endomembrane system, intracellular; EXPRESSED IN: 24 plant structures; EXPRESSED DURING: 15 growth stages; CONTAINS InterPro DOMAIN/s: ADP-ribosylation factor (InterPro:IPR006688), Small GTP-binding protein (InterPro:IPR005225), ARF/SAR superfamily (InterPro:IPR006689); BEST Arabidopsis thaliana protein match is: ADP-ribosylation factor 1 (TAIR:AT1G23490.1); Has 17774 Blast hits to 17763 proteins in 550 species: Archae - 23; Bacteria - 45; Metazoa - 8202; Fungi - 2537; Plants - 2915; Viruses - 3; Other Eukaryotes - 4049 (source: NCBI BLink)." /codon_start=1 /product="ADP-ribosylation factor C1" /protein_id="NP_188935.1" /db_xref="GeneID:821868" /db_xref="TAIR:AT3G22950" /db_xref="Araport:AT3G22950" /translation="
MGAFMSRFWFMMFPAKEYKIVVVGLDNAGKTTTLYKLHLGEVVTTHPTVGSNVEELVYKNIRFEVWDLGGQDRLRTSWATYYRGTHAVIVVIDSTDRARISFMKDELARLLGHEDLQNSVILVFANKQDLKDAMTPAEITDALNLHSIKNHDWHIQASCAVTGEGLYDGLGWIAQKVTGKATS"
misc_feature 262..783 /gene="ARFC1" /locus_tag="AT3G22950" /gene_synonym="ADP-ribosylation factor C1; ATARFC1" /note="Arf-like 5 (Arl5) and 8 (Arl8) GTPases; Region: Arl5_Arl8; cd04153" /db_xref="CDD:133353" misc_feature 325..348 /gene="ARFC1" /locus_tag="AT3G22950" /gene_synonym="ADP-ribosylation factor C1; ATARFC1" /note="G1 box; other site" /db_xref="CDD:133353" misc_feature order(331..351,631..636,640..642,730..735) /gene="ARFC1" /locus_tag="AT3G22950" /gene_synonym="ADP-ribosylation factor C1; ATARFC1" /note="GTP/Mg2+ binding site [chemical binding]; other site" /db_xref="CDD:133353" misc_feature order(331..336,346..348,358..360,394..417,481..483, 496..498) /gene="ARFC1" /locus_tag="AT3G22950" /gene_synonym="ADP-ribosylation factor C1; ATARFC1" /note="putative GAP interaction site [polypeptide binding]; other site" /db_xref="CDD:133353" misc_feature 361..408 /gene="ARFC1" /locus_tag="AT3G22950" /gene_synonym="ADP-ribosylation factor C1; ATARFC1" /note="Switch I region; other site" /db_xref="CDD:133353" misc_feature order(397..411,424..426,454..456,466..468,484..486, 490..498) /gene="ARFC1" /locus_tag="AT3G22950" /gene_synonym="ADP-ribosylation factor C1; ATARFC1" /note="putative GEF interaction site [polypeptide binding]; other site" /db_xref="CDD:133353" misc_feature 397..399 /gene="ARFC1" /locus_tag="AT3G22950" /gene_synonym="ADP-ribosylation factor C1; ATARFC1" /note="G2 box; other site" /db_xref="CDD:133353" misc_feature order(400..423,451..453,484..486,493..498) /gene="ARFC1" /locus_tag="AT3G22950" /gene_synonym="ADP-ribosylation factor C1; ATARFC1" /note="putative effector interaction site [active]" /db_xref="CDD:133353" misc_feature order(409..429,436..453) /gene="ARFC1" /locus_tag="AT3G22950" /gene_synonym="ADP-ribosylation factor C1; ATARFC1" /note="interswitch region [active]" /db_xref="CDD:133353" misc_feature 454..507 /gene="ARFC1" /locus_tag="AT3G22950" /gene_synonym="ADP-ribosylation factor C1; ATARFC1" /note="Switch II region; other site" /db_xref="CDD:133353" misc_feature 454..465 /gene="ARFC1" /locus_tag="AT3G22950" /gene_synonym="ADP-ribosylation factor C1; ATARFC1" /note="G3 box; other site" /db_xref="CDD:133353" misc_feature 631..642 /gene="ARFC1" /locus_tag="AT3G22950" /gene_synonym="ADP-ribosylation factor C1; ATARFC1" /note="G4 box; other site" /db_xref="CDD:133353" misc_feature 730..738 /gene="ARFC1" /locus_tag="AT3G22950" /gene_synonym="ADP-ribosylation factor C1; ATARFC1" /note="G5 box; other site" /db_xref="CDD:133353" ORIGIN
cgtctttggcgtcgtggctaatggcggtgacgtgttcggtgccattacggtagaggctgcagccgtttggttttgacattgtttcccgcatacttttcttcttcttcttctctccacccatctgctttaaggaaggaacctcaaaagcttacaaaatagtagaagaagaactttttttgatctccgattcttacctctgcaatcttcagattctagctgattcaaggatcttgtttgtgatagaaattggaggagatgggagcattcatgtcgaggttttggttcatgatgtttcctgcaaaagagtataagattgttgttgttggtttggataatgctggtaaaacgacgacgctttataaacttcatttgggtgaagttgttactactcatcctactgttggtagcaatgttgaagagcttgtctacaagaatattcgctttgaggtatgggatcttggtgggcaagataggctaagaacttcatgggcaacatactatcgtggaacacatgctgtgattgtggttatagatagcacagacagagccagaatctctttcatgaaagatgagctagccaggttacttggtcatgaggatcttcaaaactcggtcatactagtttttgcaaacaaacaggatctgaaagacgcaatgactcctgctgagatcacggatgcacttaaccttcacagtatcaagaaccatgattggcatattcaagcaagttgtgcggttactggagaaggattgtatgatgggctcggttggattgcccaaaaagttaccggtaaagccacgagttaaggggaaaccagaactgaatcagagagagtacgtactattcttctttgtttcttttgtctccttcatatgttctttaacattgtatcctcttgacttttatgtaacaagcttcaactattttggttgctctcattgaaactgtgtccagaattttcatatatggaagaaaaaaatcttgtttt
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]