GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-07-11 08:03:57, GGRNA.v2 : RefSeq release 229 (Mar, 2025)

LOCUS       NM_001203022             973 bp    mRNA    linear   PLN 20-OCT-2022
DEFINITION  Arabidopsis thaliana ADP-ribosylation factor C1 (ARFC1), mRNA.
ACCESSION   NM_001203022
VERSION     NM_001203022.1
DBLINK      BioProject: PRJNA116
            BioSample: SAMN03081427
KEYWORDS    RefSeq.
SOURCE      Arabidopsis thaliana (thale cress)
  ORGANISM  Arabidopsis thaliana
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
            Pentapetalae; rosids; malvids; Brassicales; Brassicaceae;
            Camelineae; Arabidopsis.
REFERENCE   1  (bases 1 to 973)
  AUTHORS   Salanoubat,M., Lemcke,K., Rieger,M., Ansorge,W., Unseld,M.,
            Fartmann,B., Valle,G., Blocker,H., Perez-Alonso,M., Obermaier,B.,
            Delseny,M., Boutry,M., Grivell,L.A., Mache,R., Puigdomenech,P., De
            Simone,V., Choisne,N., Artiguenave,F., Robert,C., Brottier,P.,
            Wincker,P., Cattolico,L., Weissenbach,J., Saurin,W., Quetier,F.,
            Schafer,M., Muller-Auer,S., Gabel,C., Fuchs,M., Benes,V.,
            Wurmbach,E., Drzonek,H., Erfle,H., Jordan,N., Bangert,S.,
            Wiedelmann,R., Kranz,H., Voss,H., Holland,R., Brandt,P.,
            Nyakatura,G., Vezzi,A., D'Angelo,M., Pallavicini,A., Toppo,S.,
            Simionati,B., Conrad,A., Hornischer,K., Kauer,G., Lohnert,T.H.,
            Nordsiek,G., Reichelt,J., Scharfe,M., Schon,O., Bargues,M.,
            Terol,J., Climent,J., Navarro,P., Collado,C., Perez-Perez,A.,
            Ottenwalder,B., Duchemin,D., Cooke,R., Laudie,M., Berger-Llauro,C.,
            Purnelle,B., Masuy,D., de Haan,M., Maarse,A.C., Alcaraz,J.P.,
            Cottet,A., Casacuberta,E., Monfort,A., Argiriou,A., flores,M.,
            Liguori,R., Vitale,D., Mannhaupt,G., Haase,D., Schoof,H., Rudd,S.,
            Zaccaria,P., Mewes,H.W., Mayer,K.F., Kaul,S., Town,C.D., Koo,H.L.,
            Tallon,L.J., Jenkins,J., Rooney,T., Rizzo,M., Walts,A.,
            Utterback,T., Fujii,C.Y., Shea,T.P., Creasy,T.H., Haas,B.,
            Maiti,R., Wu,D., Peterson,J., Van Aken,S., Pai,G., Militscher,J.,
            Sellers,P., Gill,J.E., Feldblyum,T.V., Preuss,D., Lin,X.,
            Nierman,W.C., Salzberg,S.L., White,O., Venter,J.C., Fraser,C.M.,
            Kaneko,T., Nakamura,Y., Sato,S., Kato,T., Asamizu,E., Sasamoto,S.,
            Kimura,T., Idesawa,K., Kawashima,K., Kishida,Y., Kiyokawa,C.,
            Kohara,M., Matsumoto,M., Matsuno,A., Muraki,A., Nakayama,S.,
            Nakazaki,N., Shinpo,S., Takeuchi,C., Wada,T., Watanabe,A.,
            Yamada,M., Yasuda,M. and Tabata,S.
  CONSRTM   European Union Chromosome 3 Arabidopsis Sequencing Consortium;
            Institute for Genomic Research; Kazusa DNA Research Institute
  TITLE     Sequence and analysis of chromosome 3 of the plant Arabidopsis
            thaliana
  JOURNAL   Nature 408 (6814), 820-822 (2000)
   PUBMED   11130713
REFERENCE   2  (bases 1 to 973)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (19-OCT-2022) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 973)
  AUTHORS   Krishnakumar,V., Cheng,C.-Y., Chan,A.P., Schobel,S., Kim,M.,
            Ferlanti,E.S., Belyaeva,I., Rosen,B.D., Micklem,G., Miller,J.R.,
            Vaughn,M. and Town,C.D.
  TITLE     Direct Submission
  JOURNAL   Submitted (17-MAY-2016) Plant Genomics, J. Craig Venter Institute,
            9704 Medical Center Dr, Rockville, MD 20850, USA
  REMARK    Protein update by submitter
REFERENCE   4  (bases 1 to 973)
  AUTHORS   Swarbreck,D., Lamesch,P., Wilks,C. and Huala,E.
  CONSRTM   TAIR
  TITLE     Direct Submission
  JOURNAL   Submitted (18-FEB-2011) Department of Plant Biology, Carnegie
            Institution, 260 Panama Street, Stanford, CA, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by TAIR and Araport.
            This record is derived from an annotated genomic sequence
            (NC_003074).
FEATURES             Location/Qualifiers
     source          1..973
                     /organism="Arabidopsis thaliana"
                     /mol_type="mRNA"
                     /db_xref="taxon:3702"
                     /chromosome="3"
                     /ecotype="Columbia"
     gene            1..973
                     /gene="ARFC1"
                     /locus_tag="AT3G22950"
                     /gene_synonym="ADP-ribosylation factor C1; ATARFC1"
                     /note="A member of ARF GTPase family. A thaliana has 21
                     members of this family, known to be essential for vesicle
                     coating and uncoating and functions in GTP-binding. Gene
                     encoding ADP-ribosylation factor and similar to
                     ADP-ribosylation factor GB:P91924 (Dugesia japonica),
                     other ARFs and ARF-like proteins."
                     /db_xref="Araport:AT3G22950"
                     /db_xref="GeneID:821868"
                     /db_xref="TAIR:AT3G22950"
     CDS             239..790
                     /gene="ARFC1"
                     /locus_tag="AT3G22950"
                     /gene_synonym="ADP-ribosylation factor C1; ATARFC1"
                     /note="ADP-ribosylation factor C1 (ARFC1); FUNCTIONS IN:
                     GTP binding; INVOLVED IN: N-terminal protein
                     myristoylation; LOCATED IN: endomembrane system,
                     intracellular; EXPRESSED IN: 24 plant structures;
                     EXPRESSED DURING: 15 growth stages; CONTAINS InterPro
                     DOMAIN/s: ADP-ribosylation factor (InterPro:IPR006688),
                     Small GTP-binding protein (InterPro:IPR005225), ARF/SAR
                     superfamily (InterPro:IPR006689); BEST Arabidopsis
                     thaliana protein match is: ADP-ribosylation factor 1
                     (TAIR:AT1G23490.1)."
                     /codon_start=1
                     /product="ADP-ribosylation factor C1"
                     /protein_id="NP_001189951.1"
                     /db_xref="GeneID:821868"
                     /db_xref="TAIR:AT3G22950"
                     /db_xref="Araport:AT3G22950"
                     /translation="
MGAFMSRFWFMMFPAKEYKIVVVGLDNAGKTTTLYKLHLGEVVTTHPTVGSNVEELVYKNIRFEVWDLGGQDRLRTSWATYYRGTHAVIVVIDSTDRARISFMKDELARLLGHEDLQNSVILVFANKQDLKDAMTPAEITDALNLHSIKNHDWHIQASCAVTGEGLYDGLGWIAQKVTGKATS"
     misc_feature    245..766
                     /gene="ARFC1"
                     /locus_tag="AT3G22950"
                     /gene_synonym="ADP-ribosylation factor C1; ATARFC1"
                     /note="Arf-like 5 (Arl5) and 8 (Arl8) GTPases; Region:
                     Arl5_Arl8; cd04153"
                     /db_xref="CDD:133353"
     misc_feature    308..331
                     /gene="ARFC1"
                     /locus_tag="AT3G22950"
                     /gene_synonym="ADP-ribosylation factor C1; ATARFC1"
                     /note="G1 box; other site"
                     /db_xref="CDD:133353"
     misc_feature    order(314..334,614..619,623..625,713..718)
                     /gene="ARFC1"
                     /locus_tag="AT3G22950"
                     /gene_synonym="ADP-ribosylation factor C1; ATARFC1"
                     /note="GTP/Mg2+ binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:133353"
     misc_feature    order(314..319,329..331,341..343,377..400,464..466,
                     479..481)
                     /gene="ARFC1"
                     /locus_tag="AT3G22950"
                     /gene_synonym="ADP-ribosylation factor C1; ATARFC1"
                     /note="putative GAP interaction site [polypeptide
                     binding]; other site"
                     /db_xref="CDD:133353"
     misc_feature    344..391
                     /gene="ARFC1"
                     /locus_tag="AT3G22950"
                     /gene_synonym="ADP-ribosylation factor C1; ATARFC1"
                     /note="Switch I region; other site"
                     /db_xref="CDD:133353"
     misc_feature    order(380..394,407..409,437..439,449..451,467..469,
                     473..481)
                     /gene="ARFC1"
                     /locus_tag="AT3G22950"
                     /gene_synonym="ADP-ribosylation factor C1; ATARFC1"
                     /note="putative GEF interaction site [polypeptide
                     binding]; other site"
                     /db_xref="CDD:133353"
     misc_feature    380..382
                     /gene="ARFC1"
                     /locus_tag="AT3G22950"
                     /gene_synonym="ADP-ribosylation factor C1; ATARFC1"
                     /note="G2 box; other site"
                     /db_xref="CDD:133353"
     misc_feature    order(383..406,434..436,467..469,476..481)
                     /gene="ARFC1"
                     /locus_tag="AT3G22950"
                     /gene_synonym="ADP-ribosylation factor C1; ATARFC1"
                     /note="putative effector interaction site [active]"
                     /db_xref="CDD:133353"
     misc_feature    order(392..412,419..436)
                     /gene="ARFC1"
                     /locus_tag="AT3G22950"
                     /gene_synonym="ADP-ribosylation factor C1; ATARFC1"
                     /note="interswitch region [active]"
                     /db_xref="CDD:133353"
     misc_feature    437..490
                     /gene="ARFC1"
                     /locus_tag="AT3G22950"
                     /gene_synonym="ADP-ribosylation factor C1; ATARFC1"
                     /note="Switch II region; other site"
                     /db_xref="CDD:133353"
     misc_feature    437..448
                     /gene="ARFC1"
                     /locus_tag="AT3G22950"
                     /gene_synonym="ADP-ribosylation factor C1; ATARFC1"
                     /note="G3 box; other site"
                     /db_xref="CDD:133353"
     misc_feature    614..625
                     /gene="ARFC1"
                     /locus_tag="AT3G22950"
                     /gene_synonym="ADP-ribosylation factor C1; ATARFC1"
                     /note="G4 box; other site"
                     /db_xref="CDD:133353"
     misc_feature    713..721
                     /gene="ARFC1"
                     /locus_tag="AT3G22950"
                     /gene_synonym="ADP-ribosylation factor C1; ATARFC1"
                     /note="G5 box; other site"
                     /db_xref="CDD:133353"
ORIGIN      
cgtctttggcgtcgtggctaatggcggtgacgtgttcggtgccattacggtagaggctgcagccgtttggttttgacattgtttcccgcatacttttcttcttcttcttctctccacccatctgctttaaggaaggaacctcaaaagcttacaaaatagtagaagaagaactttttttgatctccgattcttacctctgcaatcttcagattctagctgattcaagaaattggaggagatgggagcattcatgtcgaggttttggttcatgatgtttcctgcaaaagagtataagattgttgttgttggtttggataatgctggtaaaacgacgacgctttataaacttcatttgggtgaagttgttactactcatcctactgttggtagcaatgttgaagagcttgtctacaagaatattcgctttgaggtatgggatcttggtgggcaagataggctaagaacttcatgggcaacatactatcgtggaacacatgctgtgattgtggttatagatagcacagacagagccagaatctctttcatgaaagatgagctagccaggttacttggtcatgaggatcttcaaaactcggtcatactagtttttgcaaacaaacaggatctgaaagacgcaatgactcctgctgagatcacggatgcacttaaccttcacagtatcaagaaccatgattggcatattcaagcaagttgtgcggttactggagaaggattgtatgatgggctcggttggattgcccaaaaagttaccggtaaagccacgagttaaggggaaaccagaactgaatcagagagagtacgtactattcttctttgtttcttttgtctccttcatatgttctttaacattgtatcctcttgacttttatgtaacaagcttcaactattttggttgctctcattgaaactgtgtccagaattttcatatatggaagaaaaaaatcttgttttg
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]