ver.2
Home
|
Help
|
Advanced search
Previous release (v1)
2025-12-09 12:45:13, GGRNA.v2 : RefSeq release 232 (Sep, 2025)
LOCUS NM_001125942 549 bp mRNA linear PLN 20-OCT-2022
DEFINITION Arabidopsis thaliana root meristem growth factor (RGF5), mRNA.
ACCESSION NM_001125942
VERSION NM_001125942.2
DBLINK BioProject: PRJNA116
BioSample: SAMN03081427
KEYWORDS RefSeq.
SOURCE Arabidopsis thaliana (thale cress)
ORGANISM Arabidopsis thaliana
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
Pentapetalae; rosids; malvids; Brassicales; Brassicaceae;
Camelineae; Arabidopsis.
REFERENCE 1 (bases 1 to 549)
AUTHORS Tabata,S., Kaneko,T., Nakamura,Y., Kotani,H., Kato,T., Asamizu,E.,
Miyajima,N., Sasamoto,S., Kimura,T., Hosouchi,T., Kawashima,K.,
Kohara,M., Matsumoto,M., Matsuno,A., Muraki,A., Nakayama,S.,
Nakazaki,N., Naruo,K., Okumura,S., Shinpo,S., Takeuchi,C., Wada,T.,
Watanabe,A., Yamada,M., Yasuda,M., Sato,S., de la Bastide,M.,
Huang,E., Spiegel,L., Gnoj,L., O'Shaughnessy,A., Preston,R.,
Habermann,K., Murray,J., Johnson,D., Rohlfing,T., Nelson,J.,
Stoneking,T., Pepin,K., Spieth,J., Sekhon,M., Armstrong,J.,
Becker,M., Belter,E., Cordum,H., Cordes,M., Courtney,L.,
Courtney,W., Dante,M., Du,H., Edwards,J., Fryman,J., Haakensen,B.,
Lamar,E., Latreille,P., Leonard,S., Meyer,R., Mulvaney,E.,
Ozersky,P., Riley,A., Strowmatt,C., Wagner-McPherson,C., Wollam,A.,
Yoakum,M., Bell,M., Dedhia,N., Parnell,L., Shah,R., Rodriguez,M.,
See,L.H., Vil,D., Baker,J., Kirchoff,K., Toth,K., King,L.,
Bahret,A., Miller,B., Marra,M., Martienssen,R., McCombie,W.R.,
Wilson,R.K., Murphy,G., Bancroft,I., Volckaert,G., Wambutt,R.,
Dusterhoft,A., Stiekema,W., Pohl,T., Entian,K.D., Terryn,N.,
Hartley,N., Bent,E., Johnson,S., Langham,S.A., McCullagh,B.,
Robben,J., Grymonprez,B., Zimmermann,W., Ramsperger,U., Wedler,H.,
Balke,K., Wedler,E., Peters,S., van Staveren,M., Dirkse,W.,
Mooijman,P., Lankhorst,R.K., Weitzenegger,T., Bothe,G., Rose,M.,
Hauf,J., Berneiser,S., Hempel,S., Feldpausch,M., Lamberth,S.,
Villarroel,R., Gielen,J., Ardiles,W., Bents,O., Lemcke,K.,
Kolesov,G., Mayer,K., Rudd,S., Schoof,H., Schueller,C.,
Zaccaria,P., Mewes,H.W., Bevan,M. and Fransz,P.
CONSRTM Kazusa DNA Research Institute; Cold Spring Harbor and Washington
University in St Louis Sequencing Consortium; European Union
Arabidopsis Genome Sequencing Consortium
TITLE Sequence and analysis of chromosome 5 of the plant Arabidopsis
thaliana
JOURNAL Nature 408 (6814), 823-826 (2000)
PUBMED 11130714
REFERENCE 2 (bases 1 to 549)
CONSRTM NCBI Genome Project
TITLE Direct Submission
JOURNAL Submitted (19-OCT-2022) National Center for Biotechnology
Information, NIH, Bethesda, MD 20894, USA
REFERENCE 3 (bases 1 to 549)
AUTHORS Krishnakumar,V., Cheng,C.-Y., Chan,A.P., Schobel,S., Kim,M.,
Ferlanti,E.S., Belyaeva,I., Rosen,B.D., Micklem,G., Miller,J.R.,
Vaughn,M. and Town,C.D.
TITLE Direct Submission
JOURNAL Submitted (17-MAY-2016) Plant Genomics, J. Craig Venter Institute,
9704 Medical Center Dr, Rockville, MD 20850, USA
REMARK Protein update by submitter
REFERENCE 4 (bases 1 to 549)
AUTHORS Swarbreck,D., Lamesch,P., Wilks,C. and Huala,E.
CONSRTM TAIR
TITLE Direct Submission
JOURNAL Submitted (18-FEB-2011) Department of Plant Biology, Carnegie
Institution, 260 Panama Street, Stanford, CA, USA
COMMENT REVIEWED REFSEQ: This record has been curated by TAIR and Araport.
This record is derived from an annotated genomic sequence
(NC_003076).
On Sep 12, 2016 this sequence version replaced NM_001125942.1.
FEATURES Location/Qualifiers
source 1..549
/organism="Arabidopsis thaliana"
/mol_type="mRNA"
/db_xref="taxon:3702"
/chromosome="5"
/ecotype="Columbia"
gene 1..549
/gene="RGF5"
/locus_tag="AT5G51451"
/gene_synonym="CLE-like7; CLEL7; GLV10; GOLVEN 10; root
meristem growth factor 5"
/note="Encodes a root meristem growth factor (RGF).
Belongs to a family of functionally redundant homologous
peptides that are secreted, tyrosine-sulfated, and
expressed mainly in the stem cell area and the innermost
layer of central columella cells. RGFs are required for
maintenance of the root stem cell niche and transit
amplifying cell proliferation. Members of this family
include: At5g60810 (RGF1), At1g13620 (RGF2), At2g04025
(RGF3), At3g30350 (RGF4), At5g51451 (RGF5), At4g16515
(RGF6), At3g02240 (RGF7), At2g03830 (RGF8) and At5g64770
(RGF9)."
/db_xref="Araport:AT5G51451"
/db_xref="GeneID:6241076"
/db_xref="TAIR:AT5G51451"
CDS 262..528
/gene="RGF5"
/locus_tag="AT5G51451"
/gene_synonym="CLE-like7; CLEL7; GLV10; GOLVEN 10; root
meristem growth factor 5"
/inference="Similar to RNA sequence,
EST:INSD:CB254353.1,INSD:CB254977.1"
/note="root meristem growth factor 5 (RGF5); FUNCTIONS IN:
molecular_function unknown; INVOLVED IN:
biological_process unknown; LOCATED IN: endomembrane
system; Has 30201 Blast hits to 17322 proteins in 780
species: Archae - 12; Bacteria - 1396; Metazoa - 17338;
Fungi - 3422; Plants - 5037; Viruses - 0; Other Eukaryotes
- 2996 (source: NCBI BLink)."
/codon_start=1
/product="root meristem growth factor"
/protein_id="NP_001119414.1"
/db_xref="GeneID:6241076"
/db_xref="TAIR:AT5G51451"
/db_xref="Araport:AT5G51451"
/translation="
MSSIHVASMILLLFLFLHHSDSRHLDNVHITASRFSLVKDQNVVSSSTSKEPVKVSRFVPGPLKHHHRRPPLLFADYPKPSTRPPRHN"
ORIGIN
cgaggtttatatgtccttttccttttgttgtttctttctctctttttgactcatgtttggcttttcccatgagcttttccagcacattcatctggattgattaaataaaaaacttgtttattctgtgatttaattcttacattcaaatacttatgcgtgaacttgctcttattatatagtctcctactacctattaagtcttttaacggttcataatcctcttagtcgttgagccttgtatgactgcttctgttgtgaccaatgagctcaatccatgttgcttcaatgatccttctcttgtttctcttcttgcatcattctgattctcgtcacctcgacaatgtccacattacagcgtctcggttttcactcgtcaaggatcaaaatgttgtctctagttcgacatctaaagaacccgttaaagtttctcggtttgtgccgggtccattgaagcaccaccatcgtcgtccaccgctcttatttgcagattatccgaagccgtccactcggcctccacgccataactgaaacctctctctttagtttttt
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]