2024-09-29 09:25:36, GGRNA.v2 : RefSeq release 225 (Jul, 2024)
LOCUS NM_001124873 575 bp mRNA linear PLN 20-OCT-2022 DEFINITION Arabidopsis thaliana transcription factor/transcription regulator (AT2G18969), partial mRNA. ACCESSION NM_001124873 VERSION NM_001124873.2 DBLINK BioProject: PRJNA116 BioSample: SAMN03081427 KEYWORDS RefSeq. SOURCE Arabidopsis thaliana (thale cress) ORGANISM Arabidopsis thaliana Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis. REFERENCE 1 (bases 1 to 575) AUTHORS Lin,X., Kaul,S., Rounsley,S., Shea,T.P., Benito,M.I., Town,C.D., Fujii,C.Y., Mason,T., Bowman,C.L., Barnstead,M., Feldblyum,T.V., Buell,C.R., Ketchum,K.A., Lee,J., Ronning,C.M., Koo,H.L., Moffat,K.S., Cronin,L.A., Shen,M., Pai,G., Van Aken,S., Umayam,L., Tallon,L.J., Gill,J.E., Adams,M.D., Carrera,A.J., Creasy,T.H., Goodman,H.M., Somerville,C.R., Copenhaver,G.P., Preuss,D., Nierman,W.C., White,O., Eisen,J.A., Salzberg,S.L., Fraser,C.M. and Venter,J.C. TITLE Sequence and analysis of chromosome 2 of the plant Arabidopsis thaliana JOURNAL Nature 402 (6763), 761-768 (1999) PUBMED 10617197 REFERENCE 2 (bases 1 to 575) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (19-OCT-2022) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 3 (bases 1 to 575) AUTHORS Krishnakumar,V., Cheng,C.-Y., Chan,A.P., Schobel,S., Kim,M., Ferlanti,E.S., Belyaeva,I., Rosen,B.D., Micklem,G., Miller,J.R., Vaughn,M. and Town,C.D. TITLE Direct Submission JOURNAL Submitted (17-MAY-2016) Plant Genomics, J. Craig Venter Institute, 9704 Medical Center Dr, Rockville, MD 20850, USA REMARK Protein update by submitter REFERENCE 4 (bases 1 to 575) AUTHORS Swarbreck,D., Lamesch,P., Wilks,C. and Huala,E. CONSRTM TAIR TITLE Direct Submission JOURNAL Submitted (18-FEB-2011) Department of Plant Biology, Carnegie Institution, 260 Panama Street, Stanford, CA, USA COMMENT REVIEWED REFSEQ: This record has been curated by TAIR and Araport. This record is derived from an annotated genomic sequence (NC_003071). On Sep 12, 2016 this sequence version replaced NM_001124873.1. COMPLETENESS: incomplete on the 5' end. FEATURES Location/Qualifiers source 1..575 /organism="Arabidopsis thaliana" /mol_type="mRNA" /db_xref="taxon:3702" /chromosome="2" /ecotype="Columbia" gene <1..575 /locus_tag="AT2G18969" /note="Encodes a atypical member of the bHLH (basic helix-loop-helix) family transcriptional factors." /db_xref="Araport:AT2G18969" /db_xref="GeneID:6240648" /db_xref="TAIR:AT2G18969" CDS 1..528 /locus_tag="AT2G18969" /inference="Similar to RNA sequence, EST:INSD:T76845.1,INSD:N37609.1" /note="BEST Arabidopsis thaliana protein match is: sequence-specific DNA binding transcription factors;transcription regulators (TAIR:AT4G30180.1); Has 30201 Blast hits to 17322 proteins in 780 species: Archae - 12; Bacteria - 1396; Metazoa - 17338; Fungi - 3422; Plants - 5037; Viruses - 0; Other Eukaryotes - 2996 (source: NCBI BLink)." /codon_start=1 /product="transcription factor/transcription regulator" /protein_id="NP_001118345.1" /db_xref="Araport:AT2G18969" /db_xref="GeneID:6240648" /db_xref="TAIR:AT2G18969" /translation="
MERQIINKRKRVFSLQPNKNPKAVFARRYVSHLVPALKKINMNKSSSKTNKQSLEQTVKHEVDMAFALSAQEFAWSRFLQQKLLSSPYDDPISTSSSPSEILERSSKRQGGEKHQDSDEEEEGGEIKKRLKELQKLLPGGEEMNMEEILSEIGSYIVCLELQMIVLKSIVQDNTS"
misc_feature 376..510 /locus_tag="AT2G18969" /note="basic helix-loop-helix (bHLH) domain found in Arabidopsis thaliana ILI1-BINDING BHLH 1 (IBH1) and similar proteins; Region: bHLH_AtIBH1_like; cd11444" /db_xref="CDD:381450" misc_feature order(376..378,385..387,394..399,406..408,433..438, 445..450,457..459,466..468,475..480,487..489,496..501, 505..510) /locus_tag="AT2G18969" /note="putative dimer interface [polypeptide binding]; other site" /db_xref="CDD:381450" ORIGIN
atggagaggcaaattataaacaagagaaagcgagtcttttctctccaaccaaacaagaaccctaaggcagttttcgcaagaagatacgtgagtcacttggttccagctcttaaaaagatcaacatgaacaaatcctcttcaaaaaccaacaaacaaagtttagaacaaaccgtgaaacatgaagtagacatggctttcgcattgtctgctcaagaattcgcgtggagccgtttcttgcaacagaagctattatcttccccttatgatgatccaattagcactagtagttctccttccgagattctagaaagatcgagcaagagacaaggtggagaaaaacaccaagacagcgacgaagaagaagaaggaggagagatcaagaagagattgaaggaattgcagaagcttttgccaggtggagaagagatgaacatggaggagattttgagtgagattggaagctacattgtatgtcttgaattgcagatgattgttttaaaatctattgtacaagataatacttcttgaatataatataattcattgtttcttctcttcaatatgataaggcgaat
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]