GGRNA ver.2 Help | Advanced search | Japanese    Previous release (v1)

2022-12-08 14:03:30, GGRNA : RefSeq release 214 (Sep, 2022)



Matches are highlighted with green background. Overlapping matches are dark colored.

PREDICTED: Procambarus clarkii trichohyalin-like (LOC123766652), mRNA. (1377 bp)
AA_position 24
XM_045755931.1 - Procambarus clarkii (red swamp crayfish) - NCBI
Leptosphaeria maculans JN3 hypothetical protein (LEMA_P077180.1), partial mRNA. (429 bp)
LEMA_P077180.1" /db_xref="GeneID:13292782" CDS 1..429 /locus_tag="LEMA_P077180.1" /codon_start=1 /product="hypothetical protein" /protein_id="XP_003843608.1" /db_xref="GeneID:13292782" /db_xref="UniProtKB/TrEMBL:E5A934" /translation="MRYSLTLMGLATLGFHILPSLSAAVPASNLALRSNTIDKRHVYTVDEDELAKRHVYGVDKDELAKRHVYGVDKDELAKRHVYGVDKDELAKRHVYGVDKDELAKRHVYGVDKDELAKRHVYGVDKDELAKRHVYGVDKDELA" ORIGIN // REFERENCE 1 (bases 1 to 429) AUTHORS Rouxel,T., Grandaubert,J., Hane,J.K., Hoede,C., van de Wouw,A.P., Couloux,A., Dominguez,V., Anthouard,V., Bally,P., Bourras,S., Cozijnsen,A.J., Ciuffetti,L.M., Degrave,A.,...
AA_position 60
XM_003843560.1 - Leptosphaeria maculans JN3 - NCBI
PREDICTED: Octopus sinensis stress response protein NST1-like (LOC115230060), mRNA. (609 bp)
method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:115230060" CDS 1..609 /gene="LOC115230060" /codon_start=1 /product="stress response protein NST1-like" /protein_id="XP_029656445.1" /db_xref="GeneID:115230060" /translation="MNRYDELVRRTDESVRRKDESVRSKDESVRRKDELVRRKDESVRRKDELVRRKDESVRRKDESVRRKDELVRRKDELVRRTDESVGRKDESVRSKDEPVRRKDELVRRKDESVRRKDELVRRKDESVRRKDESVRRKDELVRRKDESVRRKDESVQRKDESVRCKDESVQRKDELVRRKDESVRRKDESWNAGCGEYHAQLK" misc_feature <46..573 /gene="LOC115230060" /note="MAEBL; Provisional; Region: PTZ00121" /db_xref="CDD:173412" ORIGIN //...
AA_position 32
XM_029800585.1 - Octopus sinensis (East Asian common octopus) - NCBI
PREDICTED: Diabrotica virgifera virgifera uncharacterized LOC114330671 (LOC114330671), mRNA. (1600 bp)
AA_position 46
XM_028280078.1 - Diabrotica virgifera virgifera (western corn rootworm) - NCBI
PREDICTED: Drosophila pseudoobscura trichohyalin (LOC26532712), mRNA. (2589 bp)
AA_position 216
XM_033379282.1 - Drosophila pseudoobscura - NCBI
PREDICTED: Cottoperca gobio putative leucine-rich repeat-containing protein DDB_G0290503 (LOC115007503), mRNA. (1684 bp)
AA_position 32
XM_029430413.1 - Cottoperca gobio - NCBI
PREDICTED: Penaeus chinensis uncharacterized LOC125035825 (LOC125035825), mRNA. (1177 bp)
AA_position 41
XM_047628064.1 - Penaeus chinensis - NCBI
Rhizophagus irregularis DAOM 181602=DAOM 197198 hypothetical protein (GLOIN_2v1524752), mRNA. (289 bp)
locus_tag="GLOIN_2v1524752" /db_xref="GeneID:36864093" CDS 43..249 /locus_tag="GLOIN_2v1524752" /note="expressed protein" /codon_start=1 /product="hypothetical protein" /protein_id="XP_025186518.1" /db_xref="GeneID:36864093" /db_xref="JGIDB:Rhiir2_1_1524752" /translation="MKIQKPKKKIKNKIKQTKDELNDKLEHTKDELYDKLEQTKDELKQELKEVKTLLTNLINNLNINSNNI" ORIGIN // REFERENCE 1 (bases 1 to 289) AUTHORS Chen,E.C.H., Morin,E., Beaudet,D., Noel,J., Yildirir,G., Ndikumana,S., Charron,P., St-Onge,C., Giorgi,J., Kruger,M., Marton,T., Ropars,J., Grigoriev,I.V., Hainaut,M., Henrissat,B., Roux,C., Martin,F. and...
AA_position 18
XM_025313793.1 - Rhizophagus irregularis DAOM 181602=DAOM 197198 - NCBI
PREDICTED: Cottoperca gobio GRIP domain-containing protein RUD3-like (LOC115010807), mRNA. (2398 bp)
AA_position 126
XM_029435602.1 - Cottoperca gobio - NCBI
PREDICTED: Thunnus albacares centriolin (cntrl), mRNA. (5180 bp)
AA_position 981
XM_044333690.1 - Thunnus albacares (yellowfin tuna) - NCBI
PREDICTED: Sebastes umbrosus C-type lectin domain family 4 member M-like (LOC119494692), transcript variant X1, mRNA. (2793 bp)
AA_position 9
XM_037780761.1 - Sebastes umbrosus (honeycomb rockfish) - NCBI
PREDICTED: Drosophila miranda trichohyalin-like (LOC108161194), mRNA. (1954 bp)
AA_position 153
XM_033393191.1 - Drosophila miranda - NCBI
PREDICTED: Nematostella vectensis DNA ligase 1-like (LOC116610563), mRNA. (2744 bp)
AA_position 23
XM_048734512.1 - Nematostella vectensis (starlet sea anemone) - NCBI
Phaseolus vulgaris hypothetical protein (PHAVU_007G166300g) mRNA, complete cds. (2020 bp)
AA_position 207
XM_007144500.1 - Phaseolus vulgaris - NCBI
PREDICTED: Trifolium pratense protein NETWORKED 4B-like (LOC123919502), transcript variant X2, mRNA. (2787 bp)
AA_position 212
XM_045971522.1 - Trifolium pratense - NCBI
PREDICTED: Trifolium pratense protein NETWORKED 4B-like (LOC123919502), transcript variant X1, mRNA. (2568 bp)
AA_position 212
XM_045971454.1 - Trifolium pratense - NCBI
Thermothielavioides terrestris NRRL 8126 uncharacterized protein (THITE_2118256), mRNA. (977 bp)
locus_tag="THITE_2118256" /db_xref="GeneID:11524225" CDS 281..721 /locus_tag="THITE_2118256" /codon_start=1 /product="uncharacterized protein" /protein_id="XP_003654994.1" /db_xref="GeneID:11524225" /db_xref="JGIDB:Thite2_2118256" /translation="MQLKNLAFVAPLLLAIAHSAPTQTGEIAKKGELVKDADEIWLWKKDELQKDADAIWLWKKDELTKDADEIWLWKRGELKAKLQKDADEIWLWKKDELAKDSDEIWLWKKGELKGKLQKDADEIWLWKKDQLGSKKLVKDADEIWLW" misc_feature 709 /locus_tag="THITE_2118256" /note="MAEBL; Provisional; Region: PTZ00121" /db_xref="CDD:173412" ORIGIN // REFERENCE 1 (bases 1 to 977) AUTHORS Berka,R.M., Grigoriev,I.V., Otillar,R., Salamov,A...
AA_position 45
XM_003654946.1 - Thermothielavioides terrestris NRRL 8126 - NCBI
Guillardia theta CCMP2712 hypothetical protein (GUITHDRAFT_149441) mRNA, complete cds. (891 bp)
AA_position 125
XM_005818125.1 - Guillardia theta CCMP2712 - NCBI
PREDICTED: Vigna umbellata protein NETWORKED 4B-like (LOC124824825), mRNA. (2544 bp)
AA_position 198
XM_047297341.1 - Vigna umbellata - NCBI
PREDICTED: Vigna angularis protein NETWORKED 4B (LOC108325156), transcript variant X3, mRNA. (1956 bp)
AA_position 198
XM_017558173.1 - Vigna angularis (adzuki bean) - NCBI
PREDICTED: Vigna angularis protein NETWORKED 4B (LOC108325156), transcript variant X2, mRNA. (1985 bp)
AA_position 198
XM_017558172.1 - Vigna angularis (adzuki bean) - NCBI
PREDICTED: Vigna angularis protein NETWORKED 4B (LOC108325156), transcript variant X1, mRNA. (2002 bp)
AA_position 198
XM_017558171.1 - Vigna angularis (adzuki bean) - NCBI
PREDICTED: Athalia rosae involucrin-like (LOC125501099), mRNA. (618 bp)
method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:125501099" CDS 1..618 /gene="LOC125501099" /codon_start=1 /product="involucrin-like" /protein_id="XP_048511958.1" /db_xref="GeneID:125501099" /translation="MEFTRHPSVIQDELNQVDRLKHEFKQLDCLKDKLNQVDRLKHEFKQLDCLKDELNQLDLLKHKFNQLDCLRDKLNQVDRLKNNFNQLDRLKHELNQLDGLKDKLNQVDRLKHEFKQLDCLKDELNQLDLLKHKFNQLDCLRDKLNQVDRLKNNFNQLDRLKHELNQLDGLKDKLNQVDRLKHEFKQLDCLKDELNQLDRLKHNCN" ORIGIN //...
AA_position 51
XM_048656001.1 - Athalia rosae (coleseed sawfly) - NCBI
Trichomonas vaginalis G3 ankyrin repeat protein, putative (TVAG_275690) partial mRNA. (1520 bp)
AA_position 132
XM_001314580.1 - Trichomonas vaginalis G3 - NCBI
PREDICTED: Vigna radiata var. radiata protein NETWORKED 4B (LOC106772009), mRNA. (2601 bp)
AA_position 207
XM_014658111.2 - Vigna radiata var. radiata (mung bean) - NCBI
PREDICTED: Papaver somniferum uncharacterized LOC113343944 (LOC113343944), mRNA. (1054 bp)
to: 100% coverage of the annotated genomic feature by RNAseq alignments" /db_xref="GeneID:113343944" CDS 16..627 /gene="LOC113343944" /codon_start=1 /product="uncharacterized protein LOC113343944" /protein_id="XP_026443814.1" /db_xref="GeneID:113343944" /translation="MQRKDKISVLQARNDELELKLHHTQVEKDELELKLHHARVEKDELELKLHHAQVEKDELVHHAQVEKDKLLFQIELLRKGKSWVEIDVVHGDETGAFQGDETDDVQGDEIDDVQGDEIDDDSFRSDEIDDEIDDDRGGDETGAVHGDETGAVQGDETGDVQGAEIDDDSLRSSKRQKRSPLVEKIITKRGRGRPPKPKKRSSS" ORIGIN //...
AA_position 28
XM_026588029.1 - Papaver somniferum (opium poppy) - NCBI
PREDICTED: Xiphophorus hellerii gastrula zinc finger protein XlCGF8.2DB-like (LOC116731626), mRNA. (1000 bp)
AA_position 22
XM_032581442.1 - Xiphophorus hellerii (green swordtail) - NCBI
PREDICTED: Sebastes umbrosus CD209 antigen-like protein C (LOC119494693), transcript variant X1, mRNA. (2837 bp)
AA_position 170
XM_037780765.1 - Sebastes umbrosus (honeycomb rockfish) - NCBI
PREDICTED: Spodoptera frugiperda zinc finger protein 184-like (LOC118280938), mRNA. (2255 bp)
AA_position 169
XM_035601348.1 - Spodoptera frugiperda (fall armyworm) - NCBI
Mitosporidium daphniae uncharacterized protein (DI09_98p30), partial mRNA. (1083 bp)
AA_position 226
XM_013380953.1 - Mitosporidium daphniae - NCBI
PREDICTED: Xiphophorus couchianus trichohyalin-like (LOC114141699), transcript variant X3, mRNA. (1998 bp)
AA_position 262
XM_028012414.1 - Xiphophorus couchianus (Monterrey platyfish) - NCBI
PREDICTED: Poecilia reticulata C-type lectin domain family 4 member G-like (LOC103477754), mRNA. (1259 bp)
AA_position 77
XM_008431052.2 - Poecilia reticulata (guppy) - NCBI
PREDICTED: Oryza sativa Japonica Group disease resistance protein PIK6-NP-like (LOC107281440), mRNA. (500 bp)
samples with support for all annotated introns" /db_xref="GeneID:107281440" CDS 168..467 /gene="LOC107281440" /codon_start=1 /product="disease resistance protein PIK6-NP-like" /protein_id="XP_015643813.1" /db_xref="GeneID:107281440" /translation="MAETVLSMARSLVGSAISKAASAAANETSLLLGVEKDIWYIKDELKTMQAFLRAAEVMKKKDELLKVWAEQIRDLSYDIEDSLMNLKSILKAKPYFVSW" misc_feature 243..>416 /gene="LOC107281440" /note="Coiled-coil domain of the potato virux X resistance protein and similar proteins; Region: RX-CC_like; cd14798" /db_xref="CDD:271353" ORIGIN //...
AA_position 42
XM_015788327.2 - Oryza sativa Japonica Group (Japanese rice) - NCBI
PREDICTED: Raphanus sativus FKBP12-interacting protein of 37 kDa-like (LOC108851773), mRNA. (1033 bp)
AA_position 52
XM_018625240.1 - Raphanus sativus (radish) - NCBI
PREDICTED: Lactuca sativa uncharacterized LOC111892000 (LOC111892000), mRNA. (699 bp)
using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:111892000" CDS 1..699 /gene="LOC111892000" /codon_start=1 /product="uncharacterized protein LOC111892000" /protein_id="XP_023743824.1" /db_xref="GeneID:111892000" /translation="MPLDLIPLPKDELVHKDVNDKLKAMIKLHQQQNSKTLDIKLAHAEYLSNRSPTYLTGHSPFEVVYGVNPYMPLDLIPLPKDELVHTDVNDKLNAMIKLHQQVRVKIETVNDMYRQNSNMHRKPRVFQDADLQNSKTLDIKLAHAEYLSNRSPTYLTGHSPFEVVYGVNPYMPLDLIPLPKDELVHTDVNDKLNAMIKLHQQVRVKIETVNDMYRQNSNMHRKPRVFQDADLV" ORIGIN //...
AA_position 10
XM_023888056.1 - Lactuca sativa - NCBI
PREDICTED: Sebastes umbrosus CD209 antigen-like protein C (LOC119494690), transcript variant X3, mRNA. (5616 bp)
AA_position 177
XM_037780753.1 - Sebastes umbrosus (honeycomb rockfish) - NCBI
Wallemia mellicola CBS 633.66 hypothetical protein mRNA. (684 bp)
WALSEDRAFT_60048" /db_xref="GeneID:18473708" CDS 286..624 /locus_tag="WALSEDRAFT_60048" /note="hypothetical protein UM05520.1; expressed protein" /codon_start=1 /product="hypothetical protein" /protein_id="XP_006957643.1" /db_xref="GeneID:18473708" /db_xref="JGIDB:Walse1_60048" /translation="MKKIKDELNRKAYLEMVGSSLFPQDEQKRKRKSVYKETKDELQVITSVLFSMVAVATAIWWAGGTMNPTYKTLLAMFGAIAIAIVETALYVIIQMRKSETGRDTEERKKKSQ" misc_feature 286..561 /locus_tag="WALSEDRAFT_60048" /note="Endoplasmic reticulum-based factor for assembly of V-ATPase; Region: Vma12; pfam11712" /db_xref="CDD:288549" ORIGIN // REFERENCE 1...
AA_position 5
XM_006957581.1 - Wallemia mellicola CBS 633.66 - NCBI
PREDICTED: Xiphophorus maculatus myb-like protein X (LOC111608070), mRNA. (1332 bp)
AA_position 91
XM_023330476.1 - Xiphophorus maculatus (southern platyfish) - NCBI
PREDICTED: Xiphophorus maculatus C-type lectin domain family 4 member M-like (LOC102236912), mRNA. (2735 bp)
AA_position 93
XM_023331359.1 - Xiphophorus maculatus (southern platyfish) - NCBI
PREDICTED: Mercurialis annua uncharacterized LOC126660969 (LOC126660969), transcript variant X3, mRNA. (1127 bp)
AA_position 147
XM_050354696.1 - Mercurialis annua - NCBI
PREDICTED: Vigna unguiculata protein NETWORKED 4B-like (LOC114191805), transcript variant X2, mRNA. (2317 bp)
AA_position 207
XM_028081208.1 - Vigna unguiculata (cowpea) - NCBI
PREDICTED: Vigna unguiculata protein NETWORKED 4B-like (LOC114191805), transcript variant X1, mRNA. (2376 bp)
AA_position 207
XM_028081207.1 - Vigna unguiculata (cowpea) - NCBI
PREDICTED: Drosophila persimilis putative leucine-rich repeat-containing protein DDB_G0290503 (LOC6593906), mRNA. (3016 bp)
AA_position 555
XM_026987349.1 - Drosophila persimilis - NCBI
PREDICTED: Helianthus annuus uncharacterized LOC118483133 (LOC118483133), mRNA. (382 bp)
including 8 samples with support for all annotated introns" /db_xref="GeneID:118483133" CDS 25..363 /gene="LOC118483133" /codon_start=1 /product="uncharacterized protein LOC118483133" /protein_id="XP_035834566.1" /db_xref="GeneID:118483133" /translation="MRSLTIFLFLFSLILIASLCDARADPDNYWKIVMKDELMPTTQDAQSQDTQRSSGADNYWKIVMKDELMPTTNQDAQSQDTQRSSSADNYWKIVMKDEIMSTTIQDAPKPPK" misc_feature 97..>192 /gene="LOC118483133" /note="Organ specific protein; Region: Organ_specific; pfam10950" /db_xref="CDD:402502" ORIGIN //...
AA_position 35
XM_035978673.1 - Helianthus annuus (common sunflower) - NCBI
PREDICTED: Acropora digitifera myosin-11-like (LOC107337720), mRNA. (1665 bp)
AA_position 204
XM_015902947.1 - Acropora digitifera - NCBI
PREDICTED: Scatophagus argus early endosome antigen 1-like (LOC124061789), mRNA. (2297 bp)
AA_position 124
XM_046394023.1 - Scatophagus argus - NCBI
PREDICTED: Mercurialis annua uncharacterized LOC126660969 (LOC126660969), transcript variant X2, mRNA. (1157 bp)
AA_position 147
XM_050354695.1 - Mercurialis annua - NCBI
PREDICTED: Ceratosolen solmsi marchali homeobox protein E60-like (LOC105366778), transcript variant X1, mRNA. (714 bp)
by RNAseq alignments, including 1 sample with support for all annotated introns" /db_xref="GeneID:105366778" CDS 46..420 /gene="LOC105366778" /codon_start=1 /product="homeobox protein E60-like isoform X1" /protein_id="XP_011503627.1" /db_xref="GeneID:105366778" /translation="MLFGERPRTRRTKVKDELIRTAVPEEKRPRTAFSIEQLARLKREFAENKYLTEQRRQALSKELGLNEAQIKIWFQNKRAKIKKASGQKNPLALQLMAQGLYNHSTVPLSKDELEQAAELQANGI" misc_feature order(124..138,142..144,193..195,211..213,250..252, 256..261,268..273,277..285,289..294) /gene="LOC105366778" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_...
AA_position 15
XM_011505325.1 - Ceratosolen solmsi marchali - NCBI
Puccinia graminis f. sp. tritici CRL 75-36-700-3 hypothetical protein (PGTG_02202), mRNA. (381 bp)
gene 381 /locus_tag="PGTG_02202" /db_xref="GeneID:10528762" CDS 1..381 /locus_tag="PGTG_02202" /codon_start=1 /product="hypothetical protein" /protein_id="XP_003321160.2" /db_xref="GeneID:10528762" /translation="MILCGYFDVACAGAATCQTLRELAAQLPSAFAAALAELKADNEAREGRAVNRHKETATQMATIKGELTSLKGQVGWVKDELTSLKEQVGLVKDELASVNTTAERIDSIKLIGSDNPGSKNPSRIML" misc_feature 106..>315 /locus_tag="PGTG_02202" /note="transferase, transferring glycosyl groups; Region: PLN02939" /db_xref="CDD:215507" ORIGIN // REFERENCE 1 (bases 1 to 381) AUTHORS Birren,B., Lander,E., Galagan,J., Nusbaum,C., Devon,K., Cuomo,C., Jaffe,D.,...
AA_position 78
XM_003321112.2 - Puccinia graminis f. sp. tritici CRL 75-36-700-3 - NCBI
PREDICTED: Mercurialis annua uncharacterized LOC126660969 (LOC126660969), transcript variant X1, mRNA. (1175 bp)
AA_position 147
XM_050354694.1 - Mercurialis annua - NCBI

Data Export:

Maximum 10000 results can be retrieved as Tab-delimited text or JSON format.

Debug Info:

Redirect URI :
lang : en | div : | spe : | query_string : aa:KDEL | format : html | download :

0.000 | 0.000 | search_start;
0.353 | 0.353 | count_done;
0.421 | 0.068 | search_done;,version,gi,length,symbol,synonym,geneid,division,source,definition&format=json
0.427 | 0.006 | cgi_end;

GGRNA ver.2 by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]