2025-09-18 13:20:48, GGRNA.v2 : RefSeq release 231 (Jul, 2025)
LOCUS XM_073401181 525 bp mRNA linear INV 22-APR-2025 DEFINITION PREDICTED: Porites lutea uncharacterized protein (LOC140951828), mRNA. ACCESSION XM_073401181 VERSION XM_073401181.1 DBLINK BioProject: PRJNA1248014 KEYWORDS RefSeq. SOURCE Porites lutea ORGANISM Porites lutea Eukaryota; Metazoa; Cnidaria; Anthozoa; Hexacorallia; Scleractinia; Fungiina; Poritidae; Porites. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_133211) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_958299795.1-RS_2025_04 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 04/10/2025 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..525 /organism="Porites lutea" /mol_type="mRNA" /db_xref="taxon:51062" /chromosome="11" gene 1..525 /gene="LOC140951828" /note="uncharacterized LOC140951828; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:140951828" CDS 48..506 /gene="LOC140951828" /codon_start=1 /product="uncharacterized protein" /protein_id="XP_073257282.1" /db_xref="GeneID:140951828" /translation="
MGSAFSSFQERRKTRVELKRKHKLYGSMSASKRKEVMRFKTRMEQQIEALNKQIASEKRALSLARANNLRKSVWSLQDQEPTKKPLAGKDFQDGQFHLSEYHRLLLEACQFAKYTSEHPLEKWTVCSLPNLYKSSVEKCQPRRWEFKTPSLS"
ORIGIN
gtttttgcgagtagacaaaccagagaaacatttgtagaataatcgatatgggaagtgcttttagttctttccaagaacgcagaaagacgagagtggaacttaaaagaaagcacaaactttatggctccatgtctgcttccaaaaggaaggaagtaatgaggttcaaaactcgaatggaacaacaaattgaagctctgaacaaacagattgctagcgaaaaaagagctctatcattagccagagctaacaatcttagaaagtctgtctggtctcttcaagatcaagagccgacaaagaaaccgctagcgggaaaagacttccaagatggccagtttcatctgtctgaatatcatagactattacttgaagcctgtcagtttgccaagtacactagtgagcatccacttgaaaagtggactgtctgttcacttcctaatttgtacaaatcttctgttgagaaatgccaaccaagacgctgggaattcaaaactccgagcctttcataaagaattgaaaaatatatgc
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]