LOCUS       XM_071420187            1458 bp    mRNA    linear   VRT 15-FEB-2025
DEFINITION  PREDICTED: Agelaius tricolor NADH-ubiquinone oxidoreductase chain
            4-like (LOC139586641), mRNA.
ACCESSION   XM_071420187
VERSION     XM_071420187.1
DBLINK      BioProject: PRJNA1221961
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Agelaius tricolor (tricolored blackbird)
  ORGANISM  Agelaius tricolor
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
            Coelurosauria; Aves; Neognathae; Neoaves; Telluraves; Australaves;
            Passeriformes; Passeroidea; Icteridae; Agelaius.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_027269388) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_023055355.1-RS_2025_02
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 02/12/2025
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..1458
                     /organism="Agelaius tricolor"
                     /mol_type="mRNA"
                     /isolate="1412-34295"
                     /db_xref="taxon:9191"
                     /chromosome="Unknown"
                     /sex="female"
                     /tissue_type="blood"
                     /dev_stage="adult"
                     /lat_lon="36.4692 N 121.7914 W"
     gene            1..1458
                     /gene="LOC139586641"
                     /note="NADH-ubiquinone oxidoreductase chain 4-like;
                     Derived by automated computational analysis using gene
                     prediction method: Gnomon. Supporting evidence includes
                     similarity to: 1 Protein"
                     /db_xref="GeneID:139586641"
     CDS             1..1458
                     /gene="LOC139586641"
                     /codon_start=1
                     /product="NADH-ubiquinone oxidoreductase chain 4-like"
                     /protein_id="XP_071276288.1"
                     /db_xref="GeneID:139586641"
                     /translation="

MGMVIMVIMVIMIGMSMGAVIMVIGMGMVIVIVIMGMVIMVRGMVIMGIVIIIMGMVIMVMVMVMVISVMVIITGMVIMVIIMGMVIMVIVIIIMVMDMVIMVIVMIMVSIIIMGMVIMMVMVIMVMVISVMVIIMGMGMVIMVIMVMVIIIGMSTGTVIMVISIGMVIMGMVIIIIIVMIMVSIIIMVMVILVMIIIMGMGMVIMVIMRMGIIVMVIISFVMVIMVMVTVMMVIMGMDTMVMIIIMGMDVVIIMGMVMVIMGIVSISIIVIVMVIVMVMIMVIMGMVIMIMVVMVMGMVIIMGMGIMVMVMVMVMVSIISFIIVIIVGMGMVIIMGMGRIMVIMAMVIIVSVMVMVSIMVMAMVIMVMVMGMVIIDIVMVIIIIIVIDIVIIDILNLIINIFILIIIIPKLSSSQPCPHLHRPLHSIPIIILIIFIPKFSLSELHPPPHCFILILIIFIPKFSLSEPHPPPHHPHPLHPEVLLV"

ORIGIN      

atgggcatggtcatcatggtcatcatggtcatcatgatcggaatgagcatgggcgcggtcatcatggtcatcggcatgggcatggtcattgtcattgtcatcatgggcatggtcatcatggtcaggggcatggtcatcatgggcattgttattatcatcatgggcatggtcatcatggtcatggtcatggtcatggtcatctcggtcatggtcatcatcacgggcatggtcatcatggtcattatcatgggcatggtcatcatggtcattgttattatcatcatggtcatggacatggtcatcatggtcatcgtcatgatcatggtcagcatcatcatcatgggcatggtcatcatgatggtcatggtcatcatggtcatggtcatctcggtcatggtcatcatcatgggcatgggcatggtcatcatggtcatcatggtcatggtcatcatcatcggaatgagcacgggcacagtcatcatggtcatcagcataggcatggtcatcatgggcatggtcatcatcatcatcattgtcatgatcatggtcagcatcatcatcatggtcatggtcatcttggtcatgatcatcatcatgggcatgggcatggtcatcatggtcatcatgagaatgggcatcatagtcatggtcatcatcagcttcgtaatggtcatcatggtcatggtcaccgtcatgatggtcatcatgggcatggacaccatggtcatgatcatcatcatgggcatggacgtggtcatcatcatgggcatggtcatggtcatcatgggcattgtcagcatcagcatcattgtcattgtcatggtcattgtcatggtcatgatcatggtcatcatgggcatggtcatcatgatcatggtggtcatggtcatgggcatggtcataatcatgggcatgggcatcatggtcatggtcatggtcatggtcatggtcagcatcatcagcttcatcatcgtcatcattgtaggcatgggcatggtcatcatcatgggcatgggcaggatcatggtcatcatggccatggtcatcattgtcagtgtcatggtcatggtcagcatcatggtcatggccatggtcatcatggtcatggtcatgggcatggtcatcattgacattgtcatggtcatcatcatcatcatcgtcatcgacattgtcatcattgacattctcaacctcatcatcaacatcttcatcctcatcatcatcatcccaaagttgtcctcatcccaaccctgccctcatcttcaccgtcctcttcattccatccccatcatcatcctcatcatcttcatcccaaagttctccttgtccgaactccatcctcctcctcattgtttcatcctcatcctcatcatcttcatcccaaagttctccttgtctgaaccccatcctcctcctcatcatcctcatcctcttcatcctgaagttctccttgtctga

//