GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-07-01 15:24:13, GGRNA.v2 : RefSeq release 229 (Mar, 2025)

LOCUS       XM_071244935             984 bp    mRNA    linear   INV 13-FEB-2025
DEFINITION  PREDICTED: Haliotis cracherodii uncharacterized protein
            slr1819-like (LOC139463678), mRNA.
ACCESSION   XM_071244935
VERSION     XM_071244935.1
DBLINK      BioProject: PRJNA1220611
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Haliotis cracherodii (black abalone)
  ORGANISM  Haliotis cracherodii
            Eukaryota; Metazoa; Spiralia; Lophotrochozoa; Mollusca; Gastropoda;
            Vetigastropoda; Lepetellida; Haliotoidea; Haliotidae; Haliotis.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_027266271) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_022045235.1-RS_2025_02
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 02/12/2025
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..984
                     /organism="Haliotis cracherodii"
                     /mol_type="mRNA"
                     /isolate="W230"
                     /db_xref="taxon:6455"
                     /chromosome="Unknown"
                     /tissue_type="Epipodial tissue"
                     /dev_stage="adult"
                     /collection_date="2020-07-20"
                     /collected_by="Blythe Marshman"
     gene            1..984
                     /gene="LOC139463678"
                     /note="uncharacterized protein slr1819-like; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 5 Proteins"
                     /db_xref="GeneID:139463678"
     CDS             1..984
                     /gene="LOC139463678"
                     /codon_start=1
                     /product="uncharacterized protein slr1819-like"
                     /protein_id="XP_071101036.1"
                     /db_xref="GeneID:139463678"
                     /translation="
MNPFNCDSVTMNLVTVNLVTLNLLTVNLVTVNLVTVNLVTVNLVTVNLVTLNFVTVNLVTVNLVTMNLVTVNLVTLNLVTMNLVTVNLVTLNPVTMNLVTVNLVTLNLVTLNLVTMNLVTLNLVTVNLVTLNLLTVNLVTVNLVTLNLVTVNFVTVNLVTVNLVTVNFVNLVTVNLVVTVNFVTVNLVTMNFVNLVTVNLVTVNLVTVNLVNLVTVNLVTVNFVTVNLLTMNLVTVNLVTVNLVTMNLVTVNLETVNFVNLVTVNLVTVNFVTMKLVTLNLVTMNLVTVNSVTVNFVTVNLVTMNLVTMNFVTVNLVRVEGLLNQTL"
ORIGIN      
atgaacccctttaactgtgacagtgtgaccatgaaccttgtgaccgtgaaccttgtgaccttaaaccttttgaccgtgaaccttgtgacagtgaaccttgtgaccgtgaaccttgtgacagtgaaccttgtgacagtgaaccttgtgaccttgaactttgtgacagtgaaccttgtgacagtgaaccttgtgaccatgaaccttgtgacagtgaaccttgtgaccttgaaccttgtgaccatgaaccttgtgaccgtgaaccttgtgaccttaaaccctgtgacaatgaaccttgtgaccgtgaaccttgtgaccttaaaccttgtgaccttgaaccttgtgaccatgaaccttgtgaccttgaaccttgtgaccgtgaaccttgtgaccttaaaccttttgaccgtgaaccttgtgacagtgaaccttgtgaccttgaaccttgtgaccgtgaactttgtgaccgtgaaccttgtgacagtgaaccttgtgacagtgaactttgtgaaccttgtgactgtgaaccttgttgtgacagtgaactttgtgaccgtgaaccttgtgaccatgaactttgtgaaccttgtgaccgtgaaccttgtgacagtgaatcttgtgaccgtgaaccttgtgaaccttgtgaccgtgaaccttgtgacagtgaactttgtgaccgtgaaccttttgaccatgaaccttgtgacagtgaaccttgtgaccgtgaaccttgtgaccatgaaccttgtgacagtgaaccttgagaccgtgaactttgtgaaccttgtgaccgtgaaccttgtgacagtgaactttgtgaccatgaagcttgtgaccttgaaccttgtgaccatgaaccttgtgacagtgaactctgtgacagtgaactttgtgacagtgaaccttgtgaccatgaaccttgtgaccatgaactttgtgacagtgaatcttgtaagagttgagggtttactgaatcaaactttgtaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]