GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-12-10 23:17:39, GGRNA.v2 : RefSeq release 232 (Sep, 2025)

LOCUS       XM_070249793            1924 bp    mRNA    linear   MAM 11-DEC-2024
DEFINITION  PREDICTED: Equus caballus dicer 1, ribonuclease III (DICER1),
            transcript variant X5, mRNA.
ACCESSION   XM_070249793
VERSION     XM_070249793.1
DBLINK      BioProject: PRJNA1194615
KEYWORDS    RefSeq.
SOURCE      Equus caballus (horse)
  ORGANISM  Equus caballus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091707) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_041296265.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/06/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1924
                     /organism="Equus caballus"
                     /mol_type="mRNA"
                     /isolate="H_3958"
                     /db_xref="taxon:9796"
                     /chromosome="24"
                     /sex="female"
                     /tissue_type="Whole blood in anticoagulant"
                     /dev_stage="adult"
                     /geo_loc_name="USA: Ithaca, New York"
                     /collection_date="2018-03-01"
                     /breed="thoroughbred"
     gene            1..1924
                     /gene="DICER1"
                     /note="dicer 1, ribonuclease III; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 63
                     long SRA reads, 2 Proteins"
                     /db_xref="GeneID:100065648"
                     /db_xref="VGNC:VGNC:17186"
     CDS             545..1924
                     /gene="DICER1"
                     /codon_start=1
                     /product="endoribonuclease Dicer isoform X3"
                     /protein_id="XP_070105894.1"
                     /db_xref="GeneID:100065648"
                     /db_xref="VGNC:VGNC:17186"
                     /translation="
MKSPALQPLSMAGLQLMTPASSPMGPFFGLPWQQEAIHDNIYTPRKYQVELLEAALDHNTIVCLNTGSGKTFIAVLLTKELSYQIRGAFSRSGKRTVFLVNSANQVAQQVSAVRTHSDLKVGEYSNLEVNASWTKEKWNQEFTKHQVLVMTCYVALNVLKNDYLSLSDINLLVFDECHLAILDHPYREIMKLCENCPSCPRILGLTASILNGKCDPEELEEKIQKLEKILKSNAETATDLVVLDRYTSQPCEIVVDCGPFTDRSGLYERLLMELEEALNFINDCNISVHSKERDSTLISKQILSDCRAVLVVLGPWCADKVAGMMVRELQKYIKHEQEELHRKFLLFTDTFLRKIHALCEEHFSPASLDLKFVTPKVIKLLEILRKYKPYERQQFESVEWYNNRNQDNYVSWSDSEDDDEDEEIEEKEKPETNFPSPFTNILCGIIFVERRYTAVVLNR"
     misc_feature    668..1261
                     /gene="DICER1"
                     /note="DEXH-box helicase domain of endoribonuclease Dicer;
                     Region: DEXHc_dicer; cd18034"
                     /db_xref="CDD:350792"
     misc_feature    order(668..679,686..688,737..760,881..883,1070..1072,
                     1163..1165)
                     /gene="DICER1"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:350792"
     misc_feature    order(845..850,917..922,995..997,1001..1006,1013..1015,
                     1088..1096)
                     /gene="DICER1"
                     /note="nucleic acid binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:350792"
     misc_feature    1355..1639
                     /gene="DICER1"
                     /note="Partner-binding domain of the endoribonuclease
                     Dicer; Region: Dicer_PBD; cd15903"
                     /db_xref="CDD:277191"
     misc_feature    order(1370..1375,1382..1384,1388..1393,1568..1573,
                     1580..1585,1592..1594,1601..1606,1613..1615)
                     /gene="DICER1"
                     /note="Trbp binding interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:277191"
     misc_feature    1658..>1921
                     /gene="DICER1"
                     /note="Members of the P-loop NTPase domain superfamily are
                     characterized by a conserved nucleotide phosphate-binding
                     motif, also referred to as the Walker A motif
                     (GxxxxGK[S/T], where x is any residue), and the Walker B
                     motif (hhhh[D/E], where h is a...; Region: P-loop
                     containing Nucleoside Triphosphate Hydrolases; cl38936"
                     /db_xref="CDD:476819"
ORIGIN      
gcggagggggcggcgcgggcgccggtgggattctccaagcggcggtgcgccgttgccgcgggccgtgcgcgggctgcaggcgagccgggcgctgcgcagtctccgcaggcgccagcgggaggggtcgaggcggaggcgcggcgcggcgcggcgcaggctgctccaggcccaggtgaatggagtaacctgacagcggggacgaggcgacggcgagcgggaggaaatggcggcggcggcggcggcgccgagcggcaccgggaggcctgggctgtgacgcgcgcgccggagcggggtccgatggttctcgaaggcccgcggcgccccgtgctgcaggttacctagggtatgaattaatacagacttggaaactgaaagaacttagaatcagcattttgagagcagaagcttgggcatgctgtgattttccaaaaaaactgctatcacaatgtcaaaatgcagttcagacaacagcaacacagagatctcaaacattaaaacgtaagctgtgctagaacaaaaatgcaatgaaagaaacactggatgaatgaaaagccctgctttgcaacccctcagcatggcaggcctgcagctcatgacccctgcttcctcaccaatgggtcctttctttggactgccatggcaacaagaagcaattcatgataacatttatacgccaagaaaatatcaggttgaactgcttgaagcggctctggatcataacaccatagtctgtttaaacactggctcagggaagacgtttatcgcagtactactcacgaaagagctgtcctaccagatcaggggcgccttcagcagaagtgggaaaaggacggtgttcttggtcaactctgccaaccaggttgctcagcaagtgtcagctgtcagaacgcattcggatctcaaggttggggaatactcaaacctagaagtcaatgcatcttggacaaaagagaaatggaaccaagagtttactaagcaccaggttcttgttatgacttgctatgtcgccttgaatgttttgaaaaatgattacttatcactgtcagacattaacctcttggtgtttgatgagtgtcatcttgcaatcctagatcacccctaccgagaaattatgaagctctgtgaaaattgtccatcatgtcctcgtattttgggactaactgcttccattttaaatgggaagtgtgatccagaggaattggaagaaaagattcagaaactggagaaaattcttaagagtaatgctgaaactgcaactgacctggtggtcttggacagatacacttctcagccatgtgagattgtggtagactgtggaccatttactgacagaagtgggctttatgaaagactgctgatggagttagaagaagcacttaatttcatcaatgactgtaacatatctgtacattcaaaagaaagagattctactttaatttctaaacagatcctgtcagactgtcgtgcggtattggtggttctgggaccctggtgtgctgataaagtggctggaatgatggtaagagagctacagaagtacatcaaacatgaacaggaggagctgcacaggaaattcctactgtttacagacactttcctgaggaagatccacgcactctgtgaagagcacttctcacctgcctcacttgacctgaaatttgtaactccgaaagtcataaaactgcttgaaatcttacgcaaatataaaccatatgagcgacagcagtttgagagcgttgagtggtataataataggaatcaggataattatgtgtcttggagtgattctgaggatgatgatgaggatgaagaaattgaagaaaaggagaagccagagacaaattttccttctccatttaccaatattttatgcggaattatttttgttgaaagaagatatacagcagttgtcttaaacaggtaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]