GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-08-20 22:53:07, GGRNA.v2 : RefSeq release 230 (May, 2025)

LOCUS       XM_069375334            1364 bp    mRNA    linear   PLN 23-OCT-2024
DEFINITION  Cladosporium halotolerans uncharacterized protein (WHR41_06729),
            mRNA.
ACCESSION   XM_069375334
VERSION     XM_069375334.1
DBLINK      BioProject: PRJNA1175685
            BioSample: SAMN14329494
KEYWORDS    RefSeq.
SOURCE      Cladosporium halotolerans
  ORGANISM  Cladosporium halotolerans
            Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina;
            Dothideomycetes; Dothideomycetidae; Cladosporiales;
            Cladosporiaceae; Cladosporium.
REFERENCE   1  (bases 1 to 1364)
  AUTHORS   Gioti,A., Siaperas,R., Nikolaivits,E., Le Goff,G., Ouazzani,J.,
            Kotoulas,G. and Topakas,E.
  TITLE     Draft Genome Sequence of a Cladosporium Species Isolated from the
            Mesophotic Ascidian Didemnum maculosum
  JOURNAL   Microbiol Resour Announc 9 (18), e00311-20 (2020)
   PUBMED   32354980
  REMARK    Publication Status: Online-Only
REFERENCE   2  (bases 1 to 1364)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (22-OCT-2024) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 1364)
  AUTHORS   Siaperas,R., Gioti,A., Topakas,E. and Kotoulas,G.
  TITLE     Direct Submission
  JOURNAL   Submitted (22-MAR-2024) IndBioCat, School of Chemical Engineering,
            National Technical University of Athens (NTUA), 9 Iroon
            Polytechniou str., Athens 15772, Greece
REFERENCE   4  (bases 1 to 1364)
  AUTHORS   Gioti,A., Siaperas,R., Nikolaivits,E., Le Goff,G., Ouazzani,J.,
            Kotoulas,G. and Topakas,E.
  TITLE     Direct Submission
  JOURNAL   Submitted (16-MAR-2020) Genetics, Hellenic Centre of Marine
            Research (HCMR), Proin Amerikaniki Vassi, P.O. Box 2214, Gournes,
            Heraklion, Crete 71500, Greece
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NW_027191478).
FEATURES             Location/Qualifiers
     source          1..1364
                     /organism="Cladosporium halotolerans"
                     /mol_type="mRNA"
                     /strain="TM138-S3"
                     /isolation_source="rock from coastal sea water"
                     /host="Didemnum maculosum"
                     /db_xref="taxon:1052096"
                     /chromosome="Unknown"
                     /geo_loc_name="Spain:Granada"
                     /lat_lon="36.719250 N 3.727528 W"
                     /collection_date="2017-03-05/2017-03-25"
     gene            1..1364
                     /locus_tag="WHR41_06729"
                     /db_xref="GeneID:96008172"
     CDS             51..1136
                     /locus_tag="WHR41_06729"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_069227378.1"
                     /db_xref="CDD:cd02998"
                     /db_xref="GeneID:96008172"
                     /db_xref="GO:0005783"
                     /db_xref="InterPro:IPR011679"
                     /db_xref="InterPro:IPR013766"
                     /db_xref="PFAM:PF00085"
                     /db_xref="PFAM:PF07749"
                     /translation="
MVRIPSFFTAALALTGASASAVKDLLPGNFDEVVLKSGKPALVEFFAPWCGHCKTLAPVYEELAAAFEHADDKVTIAKVDADAHKELGRKWGVQGFPTLKWFDGKSDKPEDYKSGRDLESLSAFVTSKTGVKTKAKKAAPSAVEMLTDTTFKEKIGAGQDALVAFTAPWCGHCKSLAPTWEKLATDFAQESGVLVAKVDCEAPNAKATAQEAGVKSYPTIKYYPAGSSEAVPYTGGRSEADLVAFLNDKAGTQRTVGGGLSALAGTIPSLDEIVRSLRSGGEKAQAELEKAAAAAKDSYADYYSKVAKKSEENAGYVEKELTRLQNLLKKGGLTADKMDDLMKRSNILNVFKGSEGGKDEL"
     misc_feature    111..425
                     /locus_tag="WHR41_06729"
                     /note="PDIa family, endoplasmic reticulum protein 38
                     (ERp38) subfamily; composed of proteins similar to the
                     P5-like protein first isolated from alfalfa, which
                     contains two redox active TRX (a) domains at the
                     N-terminus, like human P5, and a C-terminal domain...;
                     Region: PDI_a_ERp38; cd02998"
                     /db_xref="CDD:239296"
     misc_feature    order(198..200,207..209,396..398)
                     /locus_tag="WHR41_06729"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:239296"
     misc_feature    474..788
                     /locus_tag="WHR41_06729"
                     /note="The thioredoxin (TRX)-like superfamily is a large,
                     diverse group of proteins containing a TRX fold. Many
                     members contain a classic TRX domain with a redox active
                     CXXC motif. They function as protein disulfide
                     oxidoreductases (PDOs), altering the redox...; Region:
                     Protein Disulfide Oxidoreductases and Other Proteins with
                     a Thioredoxin fold; cl00388"
                     /db_xref="CDD:469754"
     misc_feature    843..1103
                     /locus_tag="WHR41_06729"
                     /note="Endoplasmic reticulum protein ERp29, C-terminal
                     domain; Region: ERp29; pfam07749"
                     /db_xref="CDD:462253"
ORIGIN      
gacagcaactcttctccaccacccatcccaaacctggaaacacaacaaccatggtccggattccctccttcttcacagcggctctggctctcacaggcgcctccgcctcggcggtcaaagatctgctgccgggcaacttcgacgaagtcgtgctcaagtccggcaagcccgcgctggtcgagttcttcgcgccgtggtgcggacactgcaagacgctggcgcccgtgtacgaggagctggcggcggccttcgagcacgccgacgacaaggtcaccatcgccaaggtcgatgccgatgcgcacaaggagctcggccgcaagtggggagtgcagggcttcccgaccctcaagtggttcgatggcaagtccgataagcccgaggactacaagagtgggcgtgatttggagagcttgagcgcatttgttacgtccaaaaccggtgtgaagaccaaggcgaagaaggcggcgcccagcgctgtggagatgttgacggataccacgttcaaggagaagattggcgctggacaggatgcgctcgttgcgttcactgcgccttggtgtggccactgcaaatccctcgccccgacctgggagaagctcgcgaccgacttcgcacaggagtccggcgtgctcgtcgctaaagtcgactgcgaggcccccaatgccaaagccaccgcgcaggaagccggtgtcaagtcctaccctacgatcaagtactaccccgctggctccagcgaagcggtgccctacaccggcggccgcagcgaggctgatctcgtggcattcctaaacgacaaggccggcactcagcgtaccgtcggtggcggtctgtccgcgctcgcaggcacgatcccgtccctggacgagatcgttcgctcgctgcgcagcggtggcgagaaggcgcaggcagagcttgagaaggctgctgctgcggccaaggatagctacgcggactactacagcaaggtcgcgaagaagagcgaggagaacgccggatacgtcgagaaggagttgactaggctgcagaacctgctgaagaagggtggcctcacggctgacaagatggacgatctgatgaagaggagcaacatcctcaatgtcttcaagggctctgagggcggtaaggacgagctctagaggagttctcatgagaattgaattgtggaatggctattattatggcctaagacgaaaagcacatcatcaaagactacggcaaaagctggtcttgtaagataattgcaatcatgattgcattgatagattacatcacaaagtccagtgtacaagcatctcgtatcatgcattgtattcatgtacaagtcgaaccatggtatcaagccagatggcttctacggttgctat
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]