GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-04-04 22:24:03, GGRNA.v2 : RefSeq release 228 (Jan, 2025)

LOCUS       XM_069322130             660 bp    mRNA    linear   INV 23-OCT-2024
DEFINITION  PREDICTED: Procambarus clarkii uncharacterized protein
            (LOC138363139), mRNA.
ACCESSION   XM_069322130
VERSION     XM_069322130.1
DBLINK      BioProject: PRJNA1171844
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Procambarus clarkii (red swamp crayfish)
  ORGANISM  Procambarus clarkii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Crustacea;
            Multicrustacea; Malacostraca; Eumalacostraca; Eucarida; Decapoda;
            Pleocyemata; Astacidea; Astacoidea; Cambaridae; Procambarus.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091159) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_040958095.1-RS_2024_10
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 10/17/2024
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..660
                     /organism="Procambarus clarkii"
                     /mol_type="mRNA"
                     /isolate="CNS0578487"
                     /db_xref="taxon:6728"
                     /chromosome="10"
                     /sex="female"
                     /tissue_type="muscle"
                     /geo_loc_name="China: Hubei,Wuhan,Caidian"
                     /lat_lon="30.41 N 113.78 E"
                     /collection_date="2018-07"
     gene            1..660
                     /gene="LOC138363139"
                     /note="uncharacterized LOC138363139; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:138363139"
     CDS             1..660
                     /gene="LOC138363139"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_069178231.1"
                     /db_xref="GeneID:138363139"
                     /translation="
MVAVFVIMAAVFVIMAAVFVIMVTVFVIMAAVFVIMAAVFVIMAAVLLIMAAVFVIPVAEFVITVAVFVITVAVFVFTVAVFVIMGAVFVIMMVVFVIIAAVFVITVAVFVFTVAVFLIMAAVFVIPVAVFVIPVAVFVITVAVFVITVAVFVIPVAVFVITVAVFVIPVAVFVITVAVFVIMVAVFVIMAAVFVIMVAVIVIMAAVFAKDHIWTFGNV"
ORIGIN      
atggtggctgtgtttgtgatcatggcggctgtgtttgtgatcatggcggctgtgtttgtgatcatggtgactgtgtttgtgatcatggcagctgtgtttgtgatcatggcggctgtgtttgtgatcatggcggctgtgcttctgatcatggcggctgtgtttgtgatccctgtggctgagtttgtgatcactgtggctgtgtttgtgatcactgtggctgtgtttgtgttcactgtggctgtgtttgtgatcatgggagctgtgtttgtgatcatgatggttgtgtttgtgatcattgcggctgtgtttgtgatcactgtggctgtgtttgtgttcactgtggctgtgtttctgatcatggcggctgtgtttgtgatccctgtggctgtgtttgtgatccctgtggctgtgtttgtgatcactgtggctgtgtttgtgatcactgtggctgtgtttgtgatccctgtggctgtgtttgtgatcactgtggctgtgtttgtgatccctgtggctgtgtttgtgatcactgtggctgtgtttgtgatcatggtggctgtgtttgtgatcatggcggctgtgtttgtgatcatggtggctgtgattgtgatcatggcagctgtgtttgcgaaagatcatatctggacatttggaaatgtttga
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]