LOCUS       XM_067541586             766 bp    mRNA    linear   VRT 23-AUG-2024
DEFINITION  PREDICTED: Emydura macquarii macquarii integrin alpha-D-like
            (LOC137148667), partial mRNA.
ACCESSION   XM_067541586
VERSION     XM_067541586.1
DBLINK      BioProject: PRJNA1122207
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Emydura macquarii macquarii
  ORGANISM  Emydura macquarii macquarii
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Archelosauria; Testudinata; Testudines; Pleurodira; Chelidae;
            Emydura.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_027130824) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_026122565.2-RS_2024_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/21/2024
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 23% of CDS bases
            ##RefSeq-Attributes-END##
            COMPLETENESS: incomplete on the 5' end.
FEATURES             Location/Qualifiers
     source          1..766
                     /organism="Emydura macquarii macquarii"
                     /mol_type="mRNA"
                     /isolate="MOO-44397"
                     /sub_species="macquarii"
                     /db_xref="taxon:1129001"
                     /chromosome="Unknown"
                     /sex="female"
                     /tissue_type="ovaries"
                     /dev_stage="adult"
                     /ecotype="Brisbane River"
                     /geo_loc_name="Australia: Queensland, Upper Brisbane
                     River"
     gene            <1..766
                     /gene="LOC137148667"
                     /note="integrin alpha-D-like; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:137148667"
     CDS             <1..525
                     /gene="LOC137148667"
                     /codon_start=1
                     /product="integrin alpha-D-like"
                     /protein_id="XP_067397687.1"
                     /db_xref="GeneID:137148667"
                     /translation="

PQLVQCVSEVATPVSKNFVKQMSEHPLLDCSIATCKKIWCTIASLELQQPLEFMIKGNISFQWVSQTQQQKVTLVSEAQIGYKEKKYTQQEGFIQRQVQTVVERYEVYNYLPIIMGSIMGGLVLLALIIAALYKVGFFTRQYKQRMEDAMEGEGAGPTQSATAGNAPASDAPKQ"

ORIGIN      

ccccagctggttcagtgcgtcagtgaggtggcaacgcctgtttccaagaactttgtgaagcagatgagcgagcatcctctactggactgctccattgccacctgtaagaagatctggtgcacaatcgcctcccttgaattgcagcagccgctggagttcatgatcaaagggaacatcagcttccagtgggtttcccagactcagcagcagaaagtgactctggtgagcgaggcccagattggatacaaggaaaagaaatacacccagcaggagggattcatccagcgccaggtgcagacagtggtggagcgctatgaggtctataactacctgcccatcatcatgggaagcatcatggggggcctggtcctgctggctctcatcatcgcagctctctacaaggtcggcttcttcacacgccagtacaagcagaggatggaggacgctatggagggcgaaggggctggccccacccagagcgccaccgctggcaacgcccctgcctccgatgcccccaaacaatagccccccccccctttacacccctcccaccggtgttgcctcctcctgcgctgctcgagacccacccctgccccgttacatttgccacctccatgatgcagaaaaactggccaacttccccgtgaaaaaaggtgtcctattgccagctagagttaattgtttttcaaattaggcttagtagaattcaatttattttatttgttcttaattttgatggagaacgttggattatatttataggcat

//