ver.2
Home
|
Help
|
Advanced search
Previous release (v1)
2026-10-06 02:21:27, GGRNA.v2 : RefSeq release 233 (Jan, 2026)
LOCUS XM_065211350 989 bp mRNA linear INV 10-MAY-2024
DEFINITION PREDICTED: Rhopilema esculentum splicing regulatory
glutamine/lysine-rich protein 1-like (LOC135692994), partial mRNA.
ACCESSION XM_065211350
VERSION XM_065211350.1
DBLINK BioProject: PRJNA1104281
KEYWORDS RefSeq; includes ab initio.
SOURCE Rhopilema esculentum
ORGANISM Rhopilema esculentum
Eukaryota; Metazoa; Cnidaria; Scyphozoa; Rhizostomeae;
Rhizostomatidae; Rhopilema.
COMMENT MODEL REFSEQ: This record is predicted by automated computational
analysis. This record is derived from a genomic sequence
(NW_027019844) annotated using gene prediction method: Gnomon.
Also see:
Documentation of NCBI's Annotation Process
##Genome-Annotation-Data-START##
Annotation Provider :: NCBI RefSeq
Annotation Status :: Full annotation
Annotation Name :: GCF_013076305.1-RS_2024_04
Annotation Pipeline :: NCBI eukaryotic genome annotation
pipeline
Annotation Software Version :: 10.2
Annotation Method :: Gnomon; cmsearch; tRNAscan-SE
Features Annotated :: Gene; mRNA; CDS; ncRNA
Annotation Date :: 04/29/2024
##Genome-Annotation-Data-END##
##RefSeq-Attributes-START##
ab initio :: 100% of CDS bases
##RefSeq-Attributes-END##
COMPLETENESS: incomplete on the 3' end.
FEATURES Location/Qualifiers
source 1..989
/organism="Rhopilema esculentum"
/mol_type="mRNA"
/isolate="edhc-2017"
/db_xref="taxon:499914"
/chromosome="Unknown"
/tissue_type="whole body"
/geo_loc_name="China: South China Sea"
/collection_date="2019"
gene 1..>989
/gene="LOC135692994"
/note="splicing regulatory glutamine/lysine-rich protein
1-like; Derived by automated computational analysis using
gene prediction method: Gnomon. Supporting evidence
includes similarity to: 1 Protein"
/db_xref="GeneID:135692994"
CDS 1..>989
/gene="LOC135692994"
/codon_start=1
/product="splicing regulatory glutamine/lysine-rich
protein 1-like"
/protein_id="XP_065067422.1"
/db_xref="GeneID:135692994"
/translation="
MQKHPGVLSNKTLMKQATHTNNNREEGNTNKDGDRKSFAQRIQQTRFHGTETARRTLRIETDERPIKGADNPRLLRRRQKELRSKDPTNQVSWNRDGKKDFENRDGRAADHRSGQPSSIETETERASLKGSSKPGSRKQRRQEGLSWIETDVLPIKGAGKPRLLRRRQKELRSKDPANQVSRNRDGKKDFVDRDGRAVDQRGGQPSSIETETERASLKGSNKPGFMEQRRIQKTRFQGTETARRTLRIETDERPIKGAGNPRLLRRRQKELLSKDPANQVSRNRDGKKDFVDRDGRAVDQRSGQPSSIETETERASLKGSNKPGFKEQRR"
ORIGIN
atgcaaaagcacccaggagttctatcaaacaagaccttgatgaaacaagcgactcacacaaacaacaatcgagaagaagggaatacaaacaaagacggagacagaaagagcttcgctcaaaggatccaacaaaccaggtttcatggaacagagacggcaagaaggactttgagaatagagacggacgagcggccgatcaaaggagcggacaaccctcgtctattgagacggagacagaaagagcttcgctcaaaggatccaacaaaccaggtttcatggaacagagacggcaagaaggactttgagaatagagacggacgagcggccgatcacaggagcgggcaaccctcgtctattgagacggagacagaaagagcttcgctcaaaggatccagcaaaccaggttcaaggaaacagagacggcaagaaggactttcgtggatagagacggacgtgctgccgatcaaaggagcgggcaaacctcgtctattgagacggagacagaaagagcttcgctcaaaggatccagcaaaccaggtttcaaggaacagagacggcaagaaggactttgtggatagagacggacgtgctgtcgatcaaaggggcgggcaaccctcgtctattgagacggagacagaaagagcttcgctcaaaggatccaacaaaccaggtttcatggaacagagacggatccagaaaaccaggtttcaaggaacagagacggcaagaaggactttgagaatagagacggacgagcggccgatcaaaggagcgggcaaccctcgtctattgagacggagacagaaagagcttctctcaaaggatccagcaaaccaggtttcaaggaacagagacggcaagaaggactttgtggatagagacggacgtgctgtcgatcaaaggagcgggcaaccctcgtctattgagacggagacagaaagagcttcgctcaaaggatccaacaaaccaggtttcaaggaacagagacg
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]