ver.2
Home
|
Help
|
Advanced search
Previous release (v1)
2025-12-10 23:44:21, GGRNA.v2 : RefSeq release 232 (Sep, 2025)
LOCUS XM_064871506 243 bp mRNA linear PLN 01-MAY-2024
DEFINITION Knufia obscura uncharacterized protein (PMZ80_003077), partial
mRNA.
ACCESSION XM_064871506
VERSION XM_064871506.1
DBLINK BioProject: PRJNA1105961
BioSample: SAMN32875987
KEYWORDS RefSeq.
SOURCE Knufia obscura
ORGANISM Knufia obscura
Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina;
Eurotiomycetes; Chaetothyriomycetidae; Chaetothyriales;
Trichomeriaceae; Knufia.
REFERENCE 1 (bases 1 to 243)
AUTHORS Chander,A.M., Teixeira,M.M., Singh,N.K., Williams,M.P.,
Parker,C.W., Leo,P., Stajich,J.E., Torok,T., Tighe,S., Mason,C.E.
and Venkateswaran,K.
TITLE Genomic and morphological characterization of Knufia obscura
isolated from the Mars 2020 spacecraft assembly facility
JOURNAL Res Sq (2023) In press
REMARK DOI: 10.21203/rs.3.rs-3376475/v1
REFERENCE 2 (bases 1 to 243)
CONSRTM NCBI Genome Project
TITLE Direct Submission
JOURNAL Submitted (30-APR-2024) National Center for Biotechnology
Information, NIH, Bethesda, MD 20894, USA
REFERENCE 3 (bases 1 to 243)
AUTHORS Teixeira,M., Chander,A.M., Stajich,J.E. and Venkateswaran,K.
TITLE Direct Submission
JOURNAL Submitted (30-JAN-2023) Faculty of Medicine, University of
Brasilia, Campus Universitario Darcy Ribeiro, Faculdade de
Medicina, Asa Norte, Brasilia, DF 70910900, Brazil
COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final
NCBI review. This record is derived from an annotated genomic
sequence (NW_027042689).
COMPLETENESS: incomplete on both ends.
FEATURES Location/Qualifiers
source 1..243
/organism="Knufia obscura"
/mol_type="mRNA"
/strain="CCFEE 5817"
/isolate="CBS 148926"
/isolation_source="Gasoline car tank"
/type_material="holotype of Knufia obscura"
/db_xref="taxon:1635080"
/chromosome="Unknown"
/geo_loc_name="Italy"
/collection_date="2019"
/collected_by="Fabiana Canini"
gene <1..>243
/locus_tag="PMZ80_003077"
/db_xref="GeneID:89996526"
CDS 1..243
/locus_tag="PMZ80_003077"
/note="EggNog:ENOG503P72A;
COG:S"
/codon_start=1
/product="uncharacterized protein"
/protein_id="XP_064731886.1"
/db_xref="GeneID:89996526"
/translation="
MATGEDALAGQEEIGITHRFPPDPANSRRICFKGLYLSIYNQKTKDRKTFEENVSEYKEFEVPAGYTCYVRVATVYFVQN"
ORIGIN
atggcgacaggggaagacgccctcgcaggacaagaagagattggaataacgcatcggttccctccagaccccgctaacagtcggagaatctgctttaaaggtttatacctttcaatctacaaccagaagacgaaagaccgaaagaccttcgaagaaaatgtatctgaatacaaagaatttgaggtaccagccggatacacttgctatgtcagagttgctacggtgtattttgtacaaaattaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]