GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-07-03 15:33:41, GGRNA.v2 : RefSeq release 229 (Mar, 2025)

LOCUS       XM_064187026             282 bp    mRNA    linear   INV 01-APR-2024
DEFINITION  Necator americanus uncharacterized protein (RB195_019256), partial
            mRNA.
ACCESSION   XM_064187026
VERSION     XM_064187026.1
DBLINK      BioProject: PRJNA1090461
            BioSample: SAMN37070185
KEYWORDS    RefSeq.
SOURCE      Necator americanus (New World hookworm)
  ORGANISM  Necator americanus
            Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida;
            Rhabditina; Rhabditomorpha; Strongyloidea; Ancylostomatidae;
            Bunostominae; Necator.
REFERENCE   1  (bases 1 to 282)
  AUTHORS   Ilik,V., Petrzelkova,K.J., Pardy,F., Fuh,T., Niatou-Singa,F.S.,
            Gouil,Q., Baker,L., Ritchie,M.E., Jex,A.R., Gazzola,D., Li,H.,
            Toshio Fujiwara,R., Zhan,B., Aroian,R.V., Pafco,B. and Schwarz,E.M.
  TITLE     A Necator americanus chromosomal reference genome
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 282)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (01-APR-2024) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 282)
  AUTHORS   Ilik,V., Petrzelkova,K.J., Pardy,F., Fuh,T., Niatou-Singa,F.S.,
            Gouil,Q., Baker,L., Ritchie,M.E., Jex,A.R., Gazzola,D., Li,H.,
            Toshio Fujiwara,R., Zhan,B., Aroian,R.V., Pafco,B. and Schwarz,E.M.
  TITLE     Direct Submission
  JOURNAL   Submitted (21-AUG-2023) Molecular Biology and Genetics, Cornell
            University, Biotechnology Bldg., 526 Campus Road, Ithaca, NY 14853,
            USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NC_087372).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..282
                     /organism="Necator americanus"
                     /mol_type="mRNA"
                     /strain="Aroian"
                     /host="Mesocricetus auratus"
                     /db_xref="taxon:51031"
                     /chromosome="II"
                     /sex="pooled male and female"
                     /tissue_type="Whole animal"
                     /dev_stage="Adults"
                     /geo_loc_name="USA: Laboratory of Raffi Aroian, Univ.
                     Massachusetts Chan Med. School, Worcester, MA"
                     /collection_date="2019/2021"
     gene            <1..>282
                     /locus_tag="RB195_019256"
                     /gene_synonym="Necator_chrII.g7049"
                     /db_xref="GeneID:89242837"
     CDS             1..282
                     /locus_tag="RB195_019256"
                     /gene_synonym="Necator_chrII.g7049"
                     /note="NECATOR_CHRII.G7049.T1"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_064042908.1"
                     /db_xref="GeneID:89242837"
                     /translation="
MRGTVDQCHADIILASSEHPLTDLEYADEVVIFTGSSTKLLHFVNLASKLAAAYGLRLRPDECMQMWISLRPRTGIRVDGQPIELFDEFCNLG"
ORIGIN      
atgcgaggaacagtagatcagtgtcatgccgatatcattctagcatcatcagaacaccccttgaccgatctcgagtacgctgacgaagttgttatattcacgggaagcagcacgaaacttctgcattttgtcaaccttgcatcgaagctggctgcagcctatggactacgtctacgccctgatgaatgcatgcagatgtggatttctttgagacctcgaacgggaatcagggtggacggacaaccgatcgaactcttcgatgagttctgcaacctgggctga
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]