2025-07-03 14:01:35, GGRNA.v2 : RefSeq release 229 (Mar, 2025)
LOCUS XM_063736643 1034 bp mRNA linear INV 08-MAR-2024 DEFINITION PREDICTED: Penaeus indicus uncharacterized LOC134769891 (LOC134769891), mRNA. ACCESSION XM_063736643 VERSION XM_063736643.1 DBLINK BioProject: PRJNA1078788 KEYWORDS RefSeq. SOURCE Penaeus indicus ORGANISM Penaeus indicus Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Crustacea; Multicrustacea; Malacostraca; Eumalacostraca; Eucarida; Decapoda; Dendrobranchiata; Penaeoidea; Penaeidae; Penaeus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_026948809) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_018983055.1-RS_2024_02 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.2 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 02/23/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1034 /organism="Penaeus indicus" /mol_type="mRNA" /isolate="CIBA_PI_04" /isolation_source="Wild caught" /db_xref="taxon:29960" /chromosome="Unknown" /tissue_type="muscle" /geo_loc_name="India: Chennai" /collection_date="2017" gene 1..1034 /gene="LOC134769891" /note="uncharacterized LOC134769891; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:134769891" CDS 2..439 /gene="LOC134769891" /codon_start=1 /product="uncharacterized protein LOC134769891" /protein_id="XP_063592713.1" /db_xref="GeneID:134769891" /translation="
MVLPSRNQLTVPHHTLLSVVMCKCSLTGMDSFRFYGVRRALERVLHGQKENDDDSDFDDNTEECPDYGSDYMPDDEELERAPLIDEPDDPPESRPGPSQQNQGHKMASSKIKRSEHPLWRQIEGQNTSLDTPEWLGEIEPSRHIL"
ORIGIN
tatggtccttcctagcagaaatcagctgactgtgccacaccacacactcctctctgttgtcatgtgcaaatgcagtctcacaggtatggattcctttcgattttatggagtgaggcgtgctttggagcgtgttcttcatggccaaaaggaaaatgatgatgacagtgattttgatgataatacagaggaatgtccagactatgggagtgattacatgccggatgatgaagagctggaacgggcaccgttgattgatgaacctgatgaccctcctgaatcaagaccaggaccttcacagcagaatcaaggtcacaagatggcttccagtaaaataaaacgtagtgagcacccactatggcgtcaaattgaaggccagaacactagcttagacacacctgaatggttgggtgagattgagccttcaaggcatatcctttgaaaatgacaaggctttgggaaagaaaggaaggggtacacaaccaggaaaagaaggctatggtggatgatgttgaggttcgggctatgaaatggatggacaataaaggcgtcactttgctgtcaacatttgcatcagcagagcctgtgggggagtgtaagaggtatgacaaaaaggctaaggctgtggtcacggtcccatgtcctgcagttgtgacagaatataataaattcatgggtggtgtggatttgatggactcactcatatcactttacagaatccacaccaggtccaagaagtattatcacaagatatttttcattttctggatgtcacagttgtgaactgttggttactataccgcagagattctagcgacctagacattcctgaacgaaaagtaatgatgcttcaggaattcaaattgttactggcagaatccctgcttcttgaagggaaaaatcccatggctaagaaaagaggtcgtccctcctctaatggaggaagtgctgcacagtttgcaaagaaaaagaaaagctcccctgccactaagcccattcctgcagaaggagtcaggacagatggatatcaccattat
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]