2025-04-04 14:17:22, GGRNA.v2 : RefSeq release 228 (Jan, 2025)
LOCUS XM_062775267 447 bp mRNA linear PLN 06-FEB-2024 DEFINITION Vanrija pseudolonga uncharacterized protein (LOC62_06G008725), partial mRNA. ACCESSION XM_062775267 VERSION XM_062775267.1 DBLINK BioProject: PRJNA1072635 BioSample: SAMN23076029 KEYWORDS RefSeq. SOURCE Vanrija pseudolonga ORGANISM Vanrija pseudolonga Eukaryota; Fungi; Dikarya; Basidiomycota; Agaricomycotina; Tremellomycetes; Trichosporonales; Trichosporonaceae; Vanrija. REFERENCE 1 (bases 1 to 447) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (06-FEB-2024) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 2 (bases 1 to 447) AUTHORS Noh,H. TITLE Direct Submission JOURNAL Submitted (04-OCT-2023) Department of Microbiology, Dankook University, 119 Dan-daero, Dongnam-gu, Cheonan-si, Cheonan 31116, South Korea REMARK Annotation added by submitter REFERENCE 3 (bases 1 to 447) AUTHORS Noh,H. and Kim,S.H. TITLE Direct Submission JOURNAL Submitted (12-NOV-2021) College of Natural Sciences, Dankook University, 119 Dan-daero, Chenan 31116, South Korea COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NC_085854). COMPLETENESS: incomplete on the 5' end. FEATURES Location/Qualifiers source 1..447 /organism="Vanrija pseudolonga" /mol_type="mRNA" /isolate="DUCC4014" /isolation_source="Shiitake mushroom" /db_xref="taxon:143232" /chromosome="6" /geo_loc_name="South Korea: Gwangju" /collection_date="2015-06" /collected_by="Seong Hwan Kim" gene <1..447 /locus_tag="LOC62_06G008725" /db_xref="GeneID:87811889" CDS 1..189 /locus_tag="LOC62_06G008725" /codon_start=1 /product="uncharacterized protein" /protein_id="XP_062631251.1" /db_xref="GeneID:87811889" /db_xref="GO:0005783" /db_xref="PFAM:PF06624" /translation="
MVNIKRKNANFAARAQAGKKTTRPSKTLQKRSATKWLVGTMLFLVVGGTVVELLRLIFLGTL"
ORIGIN
atggtaaacatcaagcgcaagaacgccaactttgccgcgcgcgcacaggcgggcaagaagacgacgcgcccgtccaagacgctccagaagcggagcgcgaccaagtggcttgttgggacgatgctgttcctcgtcgttggcggaactgtcgtcgagctcttgcgcctcatcttcctcggcactctttgagcgggttcggcgtgagagggatggacgggggaggcggaggagcgaggatgaaggaggctgaccgacacgacacgacgtggcgaccgagaccgacgtggcgcggatatggaggcagcaggcgacggcgactctggcggtgggcaacggcgacggtgacagtacagcgacagcgacagcgcggccgctaccccgactccgaccccagcccccgccccacccaacacgactcatgtgttgacactgtagtactgtataccc
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]